+ USE_DATABASE_REPLICATED=0
+ USE_SHARED_CATALOG=0
++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=America/Campo_Grande
+ echo 'Chosen random timezone America/Campo_Grande'
+ ln -snf /usr/share/zoneinfo/America/Campo_Grande /etc/localtime
Chosen random timezone America/Campo_Grande
+ echo America/Campo_Grande
+ dpkg -i package_folder/clickhouse-common-static_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 48430 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-common-static (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-common-static (24.8.14.10546.altinitytest+asan) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 48457 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-common-static-dbg (24.8.14.10546.altinitytest+asan) ...
+ dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-odbc-bridge.
(Reading database ... 48464 files and directories currently installed.)
Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-odbc-bridge (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-odbc-bridge (24.8.14.10546.altinitytest+asan) ...
+ dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-library-bridge.
(Reading database ... 48470 files and directories currently installed.)
Preparing to unpack .../clickhouse-library-bridge_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-library-bridge (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-library-bridge (24.8.14.10546.altinitytest+asan) ...
+ dpkg -i package_folder/clickhouse-server_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 48476 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-server (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-server (24.8.14.10546.altinitytest+asan) ...
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.8.14.10546.altinitytest+asan_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 48493 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.8.14.10546.altinitytest+asan_amd64.deb ...
Unpacking clickhouse-client (24.8.14.10546.altinitytest+asan) ...
Setting up clickhouse-client (24.8.14.10546.altinitytest+asan) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.8.14.10546.altinitytest (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
+++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ source /utils.lib
++ sysctl kernel.core_pattern=core.%e.%p-%P
kernel.core_pattern = core.%e.%p-%P
++ sysctl fs.suid_dumpable=1
fs.suid_dumpable = 1
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml
+ value=0
+ sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=42321920
+ sed --follow-symlinks -i 's|[[:digit:]]\+|42321920|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=20215808
+ sed --follow-symlinks -i 's|[[:digit:]]\+|20215808|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ '' == \1 ]]
+ [[ '' == \1 ]]
+ [[ -n 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n 0 ]]
+ [[ 0 -eq 1 ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3)
Runtime: go1.22.5 linux/amd64
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Copyright: 2015-2024 MinIO, Inc.
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ ./minio server --address :11111 ./minio_data
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
INFO: Formatting 1st pool, 1 set(s), 1 drives per set.
INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable.
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:37447 http://127.0.0.1:37447
Docs: https://min.io/docs/minio/linux/index.html
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./18C2A085D45EFDE07dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 285 root 8u IPv6 20192 0t0 TCP *:11111 (LISTEN)
minio 285 root 9u IPv4 20191 0t0 TCP localhost:11111 (LISTEN)
minio 285 root 10u IPv6 20193 0t0 TCP localhost:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy attach clickminio readwrite --user=test
Attached Policies: [readwrite]
To User: test
+ ./mc mb --ignore-existing clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc anonymous set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
+ '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']'
+ ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data`
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 89.98 MiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 125M
drwxr-xr-x 1 root root 4.0K Jul 15 21:21 .
drwxr-xr-x 1 root root 4.0K Jul 15 21:21 ..
-rw-rw-r-- 1 1000 1000 119 Jul 15 21:16 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2.4K May 6 11:10 attach_gdb.lib
-rw-r--r-- 1 root root 52 Jul 15 21:21 AzuriteConfig
-rw-r--r-- 1 root root 1.3K Jul 15 21:21 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Jul 15 21:21 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.6K Jul 15 21:21 azurite_log
lrwxrwxrwx 1 root root 7 Apr 9 22:21 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Jul 15 21:21 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 1.9K Jul 15 21:16 broken_tests.json
drwxr-xr-x 14 root root 3.8K Jul 15 21:20 dev
-rwxr-xr-x 1 root root 0 Jul 15 21:20 .dockerenv
drwxr-xr-x 1 root root 4.0K Jul 15 21:21 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 9 22:21 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 9 22:21 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26M May 6 11:37 mc
drwxr-xr-x 2 root root 4.0K Apr 9 22:21 media
-rwxr-xr-x 1 root root 99M May 6 11:37 minio
drwxr-xr-x 4 root root 4.0K Jul 15 21:21 minio_data
drwxr-xr-x 2 root root 4.0K Apr 9 22:21 mnt
drwxr-xr-x 1 root root 4.0K May 6 11:02 opt
-rw-r--r-- 1 root root 0 Mar 24 15:40 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Jul 15 21:20 package_folder
dr-xr-xr-x 316 root root 0 Jul 15 21:20 proc
-rwxrwxr-x 1 root root 11K May 6 11:01 process_functional_tests_result.py
-rw-rw-r-- 1 root root 837 May 6 11:10 requirements.txt
drwx------ 1 root root 4.0K Jul 15 21:21 root
drwxr-xr-x 1 root root 4.0K Jul 15 21:21 run
-rwxrwxr-x 1 root root 22K May 6 11:10 run.sh
lrwxrwxrwx 1 root root 8 Apr 9 22:21 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K May 6 11:10 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 May 6 11:10 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K May 6 11:10 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Apr 9 22:21 srv
-rw-rw-r-- 1 root root 14K May 6 11:10 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jul 15 21:20 sys
drwxrwxr-x 2 1000 1000 4.0K Jul 15 21:20 test_output
drwxrwxrwt 1 root root 4.0K May 6 11:37 tmp
drwxr-xr-x 1 root root 4.0K Apr 9 22:21 usr
-rw-rw-r-- 1 root root 897 May 6 11:10 utils.lib
drwxr-xr-x 1 root root 4.0K Apr 9 22:31 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 406 clickhouse 322u IPv4 34485 0t0 TCP localhost:12222 (LISTEN)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ export IS_FLAKY_CHECK=0
+ IS_FLAKY_CHECK=0
+ '[' 1 -gt 1 ']'
+ sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR)
+ sleep 1
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 -
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "PUT /devstoreaccount1/cont/arkmrnxadwazgvymrafkbwzrngwkgigt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "GET /devstoreaccount1/cont/arkmrnxadwazgvymrafkbwzrngwkgigt HTTP/1.1" 206 4
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "GET /devstoreaccount1/cont/arkmrnxadwazgvymrafkbwzrngwkgigt HTTP/1.1" 206 2
127.0.0.1 - - [16/Jul/2026:01:21:57 +0000] "DELETE /devstoreaccount1/cont/arkmrnxadwazgvymrafkbwzrngwkgigt HTTP/1.1" 202 -
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ [[ ahxB =~ e ]]
++ set_e=false
++ set +e
++ local total_retries=5
++ shift
++ local retry=0
++ '[' 0 -ge 5 ']'
++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)'
++ false
++ return
+ IS_ASAN=1
+ [[ 1 = \1 ]]
+ echo 'ASAN build detected. Not using gdb since it disables LeakSanitizer detections'
+ clickhouse-client --query 'CREATE TABLE minio_audit_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
ASAN build detected. Not using gdb since it disables LeakSanitizer detections
+ clickhouse-client --query 'CREATE TABLE minio_server_logs
(
log String,
event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'')
)
ENGINE = MergeTree
ORDER BY tuple()'
+ ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
+ ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500
Successfully applied new settings.
clickminio restart attempt 1:
+ max_retries=100
+ retry=1
+ '[' 1 -le 100 ']'
+ echo 'clickminio restart attempt 1:'
++ ./mc admin service restart clickminio --wait --json
++ jq -r .status
INFO: Restarting on service signal
MinIO Object Storage Server
Copyright: 2015-2026 MinIO, Inc.
License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html
Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64)
API: http://172.17.0.2:11111 http://127.0.0.1:11111
WebUI: http://172.17.0.2:38483 http://127.0.0.1:38483
Docs: https://min.io/docs/minio/linux/index.html
Output of restart status: success
success
Restarted clickminio successfully.
+ output='success
success'
+ echo 'Output of restart status: success
success'
+ expected_output='success
success'
+ '[' 'success
success' = 'success
success' ']'
+ echo 'Restarted clickminio successfully.'
+ break
+ '[' 1 -gt 100 ']'
+ MC_ADMIN_PID=1446
+ ./mc admin trace clickminio
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ run_tests
+ set -x
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ 0 -eq 1 ]]
+ [[ '' -eq 1 ]]
+ [[ 0 -eq 1 ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 0 ]]
+ [[ -n 2 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ true
+ set -e
+ return
+ set +e
+ TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}")
+ tee -a test_output/test_result.txt
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
2026-07-15 21:22:01 Using queries from '/usr/share/clickhouse-test/queries' directory
2026-07-15 21:22:01 Connecting to ClickHouse server... OK
2026-07-15 21:22:01 Connected to server 24.8.14.10546.altinitytest @ 058cc770af9204c1940b436324c4a7ac306572bf HEAD
2026-07-15 21:22:02 Found 3254 parallel tests and 282 sequential tests
2026-07-15 21:22:03 Running about 406 stateless tests (Process-4).
2026-07-15 21:22:03 00227_quantiles_timing_arbitrary_order: [ OK ] 0.90 sec.
2026-07-15 21:22:03 Running about 406 stateless tests (Process-10).
2026-07-15 21:22:03 01019_array_fill: [ OK ] 1.06 sec.
2026-07-15 21:22:03 Running about 406 stateless tests (Process-8).
2026-07-15 21:22:03 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 1.25 sec.
2026-07-15 21:22:03 Running about 406 stateless tests (Process-6).
2026-07-15 21:22:03 01523_interval_operator_support_string_literal: [ OK ] 1.41 sec.
2026-07-15 21:22:04 Running about 406 stateless tests (Process-3).
2026-07-15 21:22:04 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 1.59 sec.
2026-07-15 21:22:04 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.68 sec.
2026-07-15 21:22:04 02260_alter_compact_part_drop_nested_column: [ OK ] 1.14 sec.
2026-07-15 21:22:05 00337_shard_any_heavy: [ OK ] 1.13 sec.
2026-07-15 21:22:05 02151_replace_regexp_all_empty_match_alternative: [ OK ] 1.35 sec.
2026-07-15 21:22:06 03215_parquet_index: [ OK ] 1.21 sec.
2026-07-15 21:22:06 02788_current_schemas_function: [ OK ] 1.04 sec.
2026-07-15 21:22:06 02110_clickhouse_local_custom_tld: [ OK ] 2.85 sec.
2026-07-15 21:22:07 03215_parallel_replicas_crash_after_refactoring: [ OK ] 1.14 sec.
2026-07-15 21:22:07 01770_add_months_ubsan: [ OK ] 0.90 sec.
2026-07-15 21:22:07 02920_alter_column_of_projections: [ OK ] 1.40 sec.
2026-07-15 21:22:08 01663_quantile_weighted_overflow: [ OK ] 0.84 sec.
2026-07-15 21:22:08 02751_multiif_to_if_crash: [ OK ] 0.84 sec.
2026-07-15 21:22:08 02113_untuple_func_alias: [ OK ] 0.90 sec.
2026-07-15 21:22:08 00851_http_insert_json_defaults: [ OK ] 5.31 sec.
2026-07-15 21:22:08 Running about 406 stateless tests (Process-7).
2026-07-15 21:22:08 00825_protobuf_format_nested_in_nested: [ OK ] 6.39 sec.
2026-07-15 21:22:09 02518_delete_on_materialized_view: [ OK ] 1.05 sec.
2026-07-15 21:22:09 01766_todatetime64_no_timezone_arg: [ OK ] 0.78 sec.
2026-07-15 21:22:09 01684_insert_specify_shard_id: [ OK ] 1.79 sec.
2026-07-15 21:22:10 02907_clickhouse_dictionary_bug: [ OK ] 3.20 sec.
2026-07-15 21:22:10 02240_asof_join_biginteger: [ OK ] 1.05 sec.
2026-07-15 21:22:11 01323_add_scalars_in_time: [ OK ] 1.34 sec.
2026-07-15 21:22:11 Running about 406 stateless tests (Process-5).
2026-07-15 21:22:11 01825_type_json_8: [ OK ] 9.38 sec.
2026-07-15 21:22:12 02677_analyzer_compound_expressions: [ OK ] 1.54 sec.
2026-07-15 21:22:12 03271_decimal_monotonic_day_of_week: [ OK ] 1.04 sec.
2026-07-15 21:22:12 00800_low_cardinality_merge_join: [ OK ] 4.07 sec.
2026-07-15 21:22:13 01554_row_number_after_cannot_read_all_data: [ OK ] 3.15 sec.
2026-07-15 21:22:13 00205_scalar_subqueries: [ OK ] 1.34 sec.
2026-07-15 21:22:13 01269_create_with_null: [ OK ] 1.14 sec.
2026-07-15 21:22:13 02875_fix_column_decimal_serialization: [ OK ] 0.94 sec.
2026-07-15 21:22:14 02002_system_table_with_tuple: [ OK ] 2.90 sec.
2026-07-15 21:22:14 02812_pointwise_array_operations: [ OK ] 1.39 sec.
2026-07-15 21:22:14 00411_merge_tree_where_const_in_set: [ OK ] 1.09 sec.
2026-07-15 21:22:15 00574_empty_strings_deserialization: [ OK ] 7.38 sec.
2026-07-15 21:22:15 03456_match_index_prefix_extraction: [ OK ] 2.49 sec.
2026-07-15 21:22:16 00404_null_literal: [ OK ] 0.84 sec.
2026-07-15 21:22:17 00976_max_execution_speed: [ OK ] 3.76 sec.
2026-07-15 21:22:17 01018_ddl_dictionaries_select: [ OK ] 2.44 sec.
2026-07-15 21:22:18 01043_h3_edge_length_m: [ OK ] 0.79 sec.
2026-07-15 21:22:18 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 3.25 sec.
2026-07-15 21:22:19 00339_parsing_bad_arrays: [ OK ] 3.46 sec.
2026-07-15 21:22:19 Running about 406 stateless tests (Process-9).
2026-07-15 21:22:19 00564_versioned_collapsing_merge_tree: [ OK ] 16.86 sec.
2026-07-15 21:22:19 02416_keeper_map: [ OK ] 3.31 sec.
2026-07-15 21:22:19 02246_clickhouse_local_drop_database: [ OK ] 5.06 sec.
2026-07-15 21:22:20 02021_prewhere_column_optimization: [ OK ] 0.95 sec.
2026-07-15 21:22:20 02237_lzma_bug: [ OK ] 10.56 sec.
2026-07-15 21:22:21 01062_pm_multiple_all_join_same_value: [ OK ] 1.35 sec.
2026-07-15 21:22:22 00723_remerge_sort: [ OK ] 2.85 sec.
2026-07-15 21:22:23 02020_cast_integer_overflow: [ OK ] 0.94 sec.
2026-07-15 21:22:23 00908_long_http_insert: [ OK ] 3.70 sec.
2026-07-15 21:22:24 02243_make_date32_mysql: [ OK ] 2.20 sec.
2026-07-15 21:22:24 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 6.73 sec.
2026-07-15 21:22:24 00719_insert_block_without_column: [ OK ] 6.17 sec.
2026-07-15 21:22:25 02986_leftpad_fixedstring: [ OK ] 1.19 sec.
2026-07-15 21:22:25 02267_output_format_prometheus: [ OK ] 1.15 sec.
2026-07-15 21:22:25 01942_dateTimeToSnowflakeID: [ OK ] 1.82 sec.
2026-07-15 21:22:26 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 1.25 sec.
2026-07-15 21:22:27 01010_pm_join_all_join_bug: [ OK ] 1.29 sec.
2026-07-15 21:22:28 02882_primary_key_index_in_function_different_types: [ OK ] 1.44 sec.
2026-07-15 21:22:28 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 8.69 sec.
2026-07-15 21:22:29 02842_vertical_merge_after_add_drop_column: [ OK ] 1.10 sec.
2026-07-15 21:22:29 03202_dynamic_null_map_subcolumn: [ OK ] 5.93 sec.
2026-07-15 21:22:29 01380_nullable_state: [ OK ] 4.06 sec.
2026-07-15 21:22:30 01308_orc_output_format_arrays: [ OK ] 6.89 sec.
2026-07-15 21:22:30 02998_projection_after_attach_partition: [ OK ] 1.35 sec.
2026-07-15 21:22:30 03013_repeat_with_nonnative_integers: [ OK ] 0.84 sec.
2026-07-15 21:22:32 01290_max_execution_speed_distributed: [ OK ] 4.72 sec.
2026-07-15 21:22:32 01651_lc_insert_tiny_log_3: [ OK ] 14.01 sec.
2026-07-15 21:22:32 02560_tuple_format: [ OK ] 2.89 sec.
2026-07-15 21:22:33 01442_h3kring_range_check: [ OK ] 1.04 sec.
2026-07-15 21:22:33 01499_json_named_tuples: [ OK ] 0.79 sec.
2026-07-15 21:22:33 02006_test_positional_arguments_on_cluster: [ OK ] 1.60 sec.
2026-07-15 21:22:34 00745_compile_scalar_subquery: [ OK ] 1.19 sec.
2026-07-15 21:22:34 02568_json_array_length: [ OK ] 1.03 sec.
2026-07-15 21:22:35 02192_comment_error: [ OK ] 4.87 sec.
2026-07-15 21:22:37 02122_parallel_formatting_CustomSeparated: [ OK ] 7.62 sec.
2026-07-15 21:22:38 00799_function_dry_run: [ OK ] 0.94 sec.
2026-07-15 21:22:39 00122_join_with_subquery_with_subquery: [ OK ] 0.80 sec.
2026-07-15 21:22:39 02834_array_exists_segfault: [ OK ] 0.78 sec.
2026-07-15 21:22:40 00751_low_cardinality_nullable_group_by: [ OK ] 5.51 sec.
2026-07-15 21:22:40 00400_client_external_options: [ OK ] 5.76 sec.
2026-07-15 21:22:41 00939_limit_by_offset: [ OK ] 1.14 sec.
2026-07-15 21:22:41 02810_fix_remove_dedundant_distinct_view: [ OK ] 1.03 sec.
2026-07-15 21:22:43 00662_array_has_nullable: [ OK ] 2.15 sec.
2026-07-15 21:22:46 01528_clickhouse_local_prepare_parts: [ OK ] 13.21 sec.
2026-07-15 21:22:48 02477_s3_request_throttler: [ OK ] 7.92 sec.
2026-07-15 21:22:48 00632_get_sample_block_cache: [ SKIPPED ] 0.00 sec.
2026-07-15 21:22:48 Reason: not running for current build
2026-07-15 21:22:48 02680_default_star: [ OK ] 0.80 sec.
2026-07-15 21:22:51 01947_mv_subquery: [ OK ] 7.14 sec.
2026-07-15 21:22:51 01923_ttl_with_modify_column: [ OK ] 2.07 sec.
2026-07-15 21:22:52 00978_ml_math: [ OK ] 0.91 sec.
2026-07-15 21:22:52 02973_dictionary_table_exception_fix: [ OK ] 1.04 sec.
2026-07-15 21:22:53 01552_dict_fixedstring: [ OK ] 0.94 sec.
2026-07-15 21:22:54 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 8.10 sec.
2026-07-15 21:22:55 00988_constraints_replication_zookeeper_long: [ OK ] 3.26 sec.
2026-07-15 21:22:55 01551_mergetree_read_in_order_spread: [ OK ] 1.16 sec.
2026-07-15 21:22:56 02006_client_test_hint_error_name: [ OK ] 0.99 sec.
2026-07-15 21:22:57 01115_join_with_dictionary: [ OK ] 4.07 sec.
2026-07-15 21:22:58 00113_shard_group_array: [ OK ] 27.56 sec.
2026-07-15 21:22:58 00936_function_result_with_operator_in: [ OK ] 1.29 sec.
2026-07-15 21:22:59 01622_constraints_where_optimization: [ OK ] 1.19 sec.
2026-07-15 21:22:59 02864_replace_regexp_string_fallback: [ OK ] 1.10 sec.
2026-07-15 21:22:59 02969_auto_format_detection: [ OK ] 24.25 sec.
2026-07-15 21:22:59 01353_low_cardinality_join_types: [ OK ] 2.10 sec.
2026-07-15 21:23:00 01690_quantilesTiming_ubsan: [ OK ] 0.84 sec.
2026-07-15 21:23:02 01505_trivial_count_with_partition_predicate: [ OK ] 1.73 sec.
2026-07-15 21:23:03 01196_max_parser_depth: [ OK ] 3.90 sec.
2026-07-15 21:23:03 01891_partition_hash_no_long_int: [ OK ] 1.08 sec.
2026-07-15 21:23:03 03012_parser_backtracking: [ OK ] 22.54 sec.
2026-07-15 21:23:04 02451_variadic_null_garbage_data: [ OK ] 1.44 sec.
2026-07-15 21:23:05 01388_clear_all_columns: [ OK ] 1.43 sec.
2026-07-15 21:23:05 02354_window_expression_with_aggregation_expression: [ OK ] 0.79 sec.
2026-07-15 21:23:05 00609_distributed_with_case_when_then: [ OK ] 1.03 sec.
2026-07-15 21:23:06 02786_parquet_big_integer_compatibility: [ OK ] 3.47 sec.
2026-07-15 21:23:07 02381_analyzer_join_final: [ OK ] 1.29 sec.
2026-07-15 21:23:07 01273_lc_fixed_string_field: [ OK ] 0.89 sec.
2026-07-15 21:23:07 02534_parquet_fixed_binary_array: [ OK ] 8.68 sec.
2026-07-15 21:23:08 00647_select_numbers_with_offset: [ OK ] 0.78 sec.
2026-07-15 21:23:08 03032_numbers_zeros: [ OK ] 1.28 sec.
2026-07-15 21:23:09 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.88 sec.
2026-07-15 21:23:09 02130_parse_quoted_null: [ OK ] 14.23 sec.
2026-07-15 21:23:10 03143_join_filter_push_down_filled_join_fix: [ OK ] 1.03 sec.
2026-07-15 21:23:10 02151_http_s_structure_set_eof: [ OK ] 4.70 sec.
2026-07-15 21:23:11 00811_garbage: [ OK ] 0.89 sec.
2026-07-15 21:23:13 02493_numeric_literals_with_underscores: [ OK ] 3.60 sec.
2026-07-15 21:23:13 02944_variant_as_common_type_analyzer: [ OK ] 2.34 sec.
2026-07-15 21:23:14 01668_avg_weighted_ubsan: [ OK ] 0.79 sec.
2026-07-15 21:23:14 02900_buffer_table_alter_race: [ OK ] 15.51 sec.
2026-07-15 21:23:15 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.94 sec.
2026-07-15 21:23:15 02039_group_by_with_totals_having: [ OK ] 0.90 sec.
2026-07-15 21:23:16 01273_arrow_arrays_load: [ OK ] 7.42 sec.
2026-07-15 21:23:16 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.84 sec.
2026-07-15 21:23:17 03246_json_simd_rapid_parsers: [ OK ] 4.01 sec.
2026-07-15 21:23:18 01318_map_populate_series: [ OK ] 1.79 sec.
2026-07-15 21:23:19 02381_join_dup_columns_in_plan: [ OK ] 2.44 sec.
2026-07-15 21:23:20 00358_from_string_complex_types: [ OK ] 0.95 sec.
2026-07-15 21:23:21 01791_dist_INSERT_block_structure_mismatch: [ OK ] 3.41 sec.
2026-07-15 21:23:23 02859_replicated_db_name_zookeeper: [ OK ] 6.93 sec.
2026-07-15 21:23:23 02842_one_input_format: [ OK ] 7.43 sec.
2026-07-15 21:23:23 02811_primary_key_in_columns: [ OK ] 2.00 sec.
2026-07-15 21:23:25 02841_join_filter_set_sparse: [ OK ] 2.00 sec.
2026-07-15 21:23:25 02553_new_type_json_attach_partition: [ OK ] 1.24 sec.
2026-07-15 21:23:26 01651_group_uniq_array_enum: [ OK ] 0.89 sec.
2026-07-15 21:23:27 01683_dist_INSERT_block_structure_mismatch: [ OK ] 1.24 sec.
2026-07-15 21:23:28 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 7.99 sec.
2026-07-15 21:23:30 00334_column_aggregate_function_limit: [ OK ] 1.05 sec.
2026-07-15 21:23:31 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.94 sec.
2026-07-15 21:23:31 02210_processors_profile_log: [ OK ] 3.52 sec.
2026-07-15 21:23:31 02122_parallel_formatting_Vertical: [ OK ] 8.49 sec.
2026-07-15 21:23:32 00411_long_accurate_number_comparison_int1: [ OK ] 71.38 sec.
2026-07-15 21:23:32 00701_join_default_strictness: [ OK ] 1.19 sec.
2026-07-15 21:23:33 02471_wrong_date_monotonicity: [ OK ] 1.25 sec.
2026-07-15 21:23:33 03073_analyzer_alias_as_column_name: [ OK ] 1.15 sec.
2026-07-15 21:23:35 02265_column_ttl: [ OK ] 3.76 sec.
2026-07-15 21:23:35 01188_attach_table_from_path: [ OK ] 1.95 sec.
2026-07-15 21:23:36 03213_rand_dos: [ OK ] 1.15 sec.
2026-07-15 21:23:38 02525_different_engines_in_temporary_tables: [ OK ] 1.75 sec.
2026-07-15 21:23:38 02843_date_predicate_optimizations_bugs: [ OK ] 0.74 sec.
2026-07-15 21:23:39 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 4.16 sec.
2026-07-15 21:23:40 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.84 sec.
2026-07-15 21:23:43 02126_url_auth: [ OK ] 3.13 sec.
2026-07-15 21:23:45 03174_multiple_authentication_methods: [ OK ] 11.61 sec.
2026-07-15 21:23:45 02874_array_random_sample: [ OK ] 20.43 sec.
2026-07-15 21:23:46 01508_explain_header: [ OK ] 0.79 sec.
2026-07-15 21:23:46 00594_alias_in_distributed: [ OK ] 2.91 sec.
2026-07-15 21:23:47 03289_explain_syntax_statistics: [ OK ] 0.85 sec.
2026-07-15 21:23:47 02311_system_zookeeper_insert: [ OK ] 2.19 sec.
2026-07-15 21:23:48 01592_toUnixTimestamp_Date: [ OK ] 0.99 sec.
2026-07-15 21:23:48 03156_nullable_number_tips: [ OK ] 1.60 sec.
2026-07-15 21:23:49 01374_if_nullable_filimonov: [ OK ] 0.80 sec.
2026-07-15 21:23:49 01782_field_oom: [ OK ] 79.81 sec.
2026-07-15 21:23:49 03060_analyzer_regular_view_alias: [ OK ] 0.89 sec.
2026-07-15 21:23:51 01230_join_get_truncate: [ OK ] 1.24 sec.
2026-07-15 21:23:53 02517_avro_bool_type: [ OK ] 3.01 sec.
2026-07-15 21:23:54 00700_decimal_arithm: [ OK ] 5.13 sec.
2026-07-15 21:23:54 01646_fix_window_funnel_inconistency: [ OK ] 1.43 sec.
2026-07-15 21:23:54 01520_client_print_query_id: [ OK ] 3.36 sec.
2026-07-15 21:23:55 01001_rename_merge_race_condition: [ OK ] 16.15 sec.
2026-07-15 21:23:55 01702_toDateTime_from_string_clamping: [ OK ] 0.99 sec.
2026-07-15 21:23:55 02464_decimal_scale_buffer_overflow: [ OK ] 1.11 sec.
2026-07-15 21:23:56 02394_every_profile_event_must_have_documentation: [ OK ] 0.96 sec.
2026-07-15 21:23:57 00854_multiple_join_asterisks: [ OK ] 1.32 sec.
2026-07-15 21:23:57 02270_errors_in_files: [ OK ] 10.82 sec.
2026-07-15 21:23:57 02475_precise_decimal_arithmetics: [ OK ] 2.31 sec.
2026-07-15 21:23:58 02001_append_output_file: [ OK ] 3.87 sec.
2026-07-15 21:23:59 01116_asof_join_dolbyzerr: [ OK ] 1.55 sec.
2026-07-15 21:23:59 01043_categorical_iv: [ OK ] 1.81 sec.
2026-07-15 21:23:59 02274_full_sort_join_nodistinct: [ OK ] 27.64 sec.
2026-07-15 21:24:00 00296_url_parameters: [ OK ] 1.61 sec.
2026-07-15 21:24:00 01509_dictionary_preallocate: [ OK ] 3.57 sec.
2026-07-15 21:24:01 02205_postgresql_functions: [ OK ] 4.18 sec.
2026-07-15 21:24:01 00143_number_classification_functions: [ OK ] 1.76 sec.
2026-07-15 21:24:01 01605_key_condition_enum_int: [ OK ] 0.91 sec.
2026-07-15 21:24:01 01017_tuplehamming_distance: [ OK ] 1.25 sec.
2026-07-15 21:24:03 01825_type_json_ghdata_insert_select: [ OK ] 52.64 sec.
2026-07-15 21:24:04 02017_bit_shift_left_for_string_integer: [ OK ] 4.87 sec.
2026-07-15 21:24:04 02174_cte_scalar_cache: [ OK ] 5.53 sec.
2026-07-15 21:24:04 01532_primary_key_without_order_by_zookeeper: [ OK ] 3.16 sec.
2026-07-15 21:24:05 02497_source_part_is_intact_when_mutation: [ OK ] 1.75 sec.
2026-07-15 21:24:05 01493_table_function_null: [ OK ] 0.91 sec.
2026-07-15 21:24:05 01198_client_quota_key: [ OK ] 4.32 sec.
2026-07-15 21:24:05 00947_ml_test: [ OK ] 1.43 sec.
2026-07-15 21:24:05 02713_ip4_uint_compare: [ OK ] 0.79 sec.
2026-07-15 21:24:06 02151_client_option_echo: [ OK ] 5.07 sec.
2026-07-15 21:24:06 01359_codeql: [ OK ] 0.74 sec.
2026-07-15 21:24:06 00975_recursive_materialized_view: [ OK ] 1.04 sec.
2026-07-15 21:24:07 00165_transform_non_const_default: [ OK ] 1.19 sec.
2026-07-15 21:24:07 02378_part_log_profile_events: [ OK ] 5.78 sec.
2026-07-15 21:24:07 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 1.74 sec.
2026-07-15 21:24:07 01621_bar_nan_arguments: [ OK ] 0.94 sec.
2026-07-15 21:24:07 03041_select_with_query_result: [ OK ] 1.04 sec.
2026-07-15 21:24:07 01403_datetime64_constant_arg: [ OK ] 0.89 sec.
2026-07-15 21:24:08 00700_decimal_defaults: [ OK ] 1.14 sec.
2026-07-15 21:24:08 02591_bson_long_tuple: [ OK ] 0.74 sec.
2026-07-15 21:24:09 02565_analyzer_limit_settings: [ OK ] 1.54 sec.
2026-07-15 21:24:09 02562_with_fill_nullable: [ OK ] 0.99 sec.
2026-07-15 21:24:10 02963_test_flexible_disk_configuration: [ OK ] 3.10 sec.
2026-07-15 21:24:10 01682_gather_utils_ubsan: [ OK ] 1.09 sec.
2026-07-15 21:24:10 02668_parse_datetime_in_joda_syntax: [ OK ] 5.81 sec.
2026-07-15 21:24:12 01596_setting_limit_offset: [ OK ] 1.66 sec.
2026-07-15 21:24:12 02518_parquet_arrow_orc_boolean_value: [ OK ] 4.11 sec.
2026-07-15 21:24:12 02763_row_policy_storage_merge_alias: [ OK ] 2.00 sec.
2026-07-15 21:24:12 01914_index_bgranvea: [ OK ] 0.94 sec.
2026-07-15 21:24:13 02887_format_readable_timedelta_subseconds: [ OK ] 1.09 sec.
2026-07-15 21:24:13 02043_query_obfuscator_embedded_dictionaries: [ OK ] 2.50 sec.
2026-07-15 21:24:13 02813_series_period_detect: [ OK ] 1.35 sec.
2026-07-15 21:24:14 02540_duplicate_primary_key2: [ OK ] 1.20 sec.
2026-07-15 21:24:15 01020_function_array_compact: [ OK ] 1.14 sec.
2026-07-15 21:24:16 00506_union_distributed: [ OK ] 2.45 sec.
2026-07-15 21:24:16 02473_multistep_prewhere: [ OK ] 68.58 sec.
2026-07-15 21:24:16 02943_variant_element: [ OK ] 1.46 sec.
2026-07-15 21:24:17 00999_settings_no_extra_quotes: [ OK ] 0.89 sec.
2026-07-15 21:24:18 02276_full_sort_join_unsupported: [ OK ] 1.50 sec.
2026-07-15 21:24:19 01134_max_rows_to_group_by: [ OK ] 1.29 sec.
2026-07-15 21:24:20 01273_arrow_nullable_arrays_load: [ OK ] 7.53 sec.
2026-07-15 21:24:20 00740_database_in_nested_view: [ OK ] 1.41 sec.
2026-07-15 21:24:21 01508_query_obfuscator: [ OK ] 2.85 sec.
2026-07-15 21:24:21 02424_pod_array_overflow: [ OK ] 0.79 sec.
2026-07-15 21:24:22 02570_fallback_from_async_insert: [ OK ] 9.55 sec.
2026-07-15 21:24:22 02097_polygon_dictionary_store_key: [ OK ] 1.15 sec.
2026-07-15 21:24:23 02293_grouping_function_group_by: [ OK ] 2.75 sec.
2026-07-15 21:24:23 02962_parallel_window_functions_different_partitioning: [ OK ] 1.04 sec.
2026-07-15 21:24:24 01796_Log_rwlock_ub: [ OK ] 1.09 sec.
2026-07-15 21:24:25 02541_empty_function_support_ip: [ OK ] 1.00 sec.
2026-07-15 21:24:26 00457_log_tinylog_stripelog_nullable: [ OK ] 2.50 sec.
2026-07-15 21:24:26 02421_type_json_async_insert: [ OK ] 18.36 sec.
2026-07-15 21:24:26 02481_default_value_used_in_row_level_filter: [ OK ] 1.10 sec.
2026-07-15 21:24:28 00311_array_primary_key: [ OK ] 1.75 sec.
2026-07-15 21:24:29 00131_set_hashed: [ OK ] 0.80 sec.
2026-07-15 21:24:30 00945_bloom_filter_index: [ OK ] 20.46 sec.
2026-07-15 21:24:30 02891_functions_over_sparse_columns: [ OK ] 1.10 sec.
2026-07-15 21:24:31 02901_analyzer_recursive_window: [ OK ] 1.00 sec.
2026-07-15 21:24:32 01880_remote_ipv6: [ OK ] 1.41 sec.
2026-07-15 21:24:36 01107_tuples_arrays_parsing_exceptions: [ OK ] 3.71 sec.
2026-07-15 21:24:36 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 6.62 sec.
2026-07-15 21:24:37 03147_asof_join_ddb_missing: [ OK ] 10.23 sec.
2026-07-15 21:24:37 01825_new_type_json_8: [ OK ] 10.71 sec.
2026-07-15 21:24:38 02003_memory_limit_in_client: [ OK ] 16.94 sec.
2026-07-15 21:24:38 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 1.02 sec.
2026-07-15 21:24:38 00804_rollup_with_having: [ OK ] 1.20 sec.
2026-07-15 21:24:39 01942_untuple_transformers_msan: [ OK ] 0.84 sec.
2026-07-15 21:24:39 00581_limit_on_result_and_subquery_and_insert: [ OK ] 1.00 sec.
2026-07-15 21:24:39 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 23.18 sec.
2026-07-15 21:24:40 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.79 sec.
2026-07-15 21:24:40 01719_join_timezone: [ OK ] 1.36 sec.
2026-07-15 21:24:41 03153_format_regexp_usability: [ OK ] 4.12 sec.
2026-07-15 21:24:41 02910_replicated_merge_parameters_must_consistent: [ OK ] 2.81 sec.
2026-07-15 21:24:41 02356_insert_query_log_metrics: [ OK ] 2.40 sec.
2026-07-15 21:24:42 00621_regression_for_in_operator: [ OK ] 1.73 sec.
2026-07-15 21:24:42 03262_analyzer_materialized_view_in_with_cte: [ OK ] 1.19 sec.
2026-07-15 21:24:42 01045_bloom_filter_null_array: [ OK ] 1.29 sec.
2026-07-15 21:24:42 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.90 sec.
2026-07-15 21:24:43 01521_format_readable_time_delta2: [ OK ] 1.90 sec.
2026-07-15 21:24:43 02832_transform_fixed_string_no_default: [ OK ] 0.94 sec.
2026-07-15 21:24:44 01521_alter_enum_and_reverse_read: [ OK ] 1.25 sec.
2026-07-15 21:24:44 01502_bar_overflow: [ OK ] 2.27 sec.
2026-07-15 21:24:45 02313_cross_join_dup_col_names: [ OK ] 0.96 sec.
2026-07-15 21:24:45 03041_recursive_cte_postgres_7: [ OK ] 2.72 sec.
2026-07-15 21:24:46 01034_JSONCompactEachRow: [ OK ] 3.31 sec.
2026-07-15 21:24:46 01656_ipv4_bad_formatting: [ OK ] 0.85 sec.
2026-07-15 21:24:47 01104_fixed_string_like: [ OK ] 2.16 sec.
2026-07-15 21:24:47 01788_update_nested_type_subcolumn_check: [ OK ] 3.15 sec.
2026-07-15 21:24:48 01042_check_query_and_last_granule_size: [ OK ] 1.45 sec.
2026-07-15 21:24:49 00521_multidimensional: [ OK ] 1.95 sec.
2026-07-15 21:24:50 02972_parallel_replicas_cte: [ OK ] 2.47 sec.
2026-07-15 21:24:51 01273_h3EdgeAngle_range_check: [ OK ] 0.90 sec.
2026-07-15 21:24:51 03038_nested_dynamic_merges_small: [ OK ] 9.27 sec.
2026-07-15 21:24:52 01785_parallel_formatting_memory: [ OK ] 5.33 sec.
2026-07-15 21:24:52 01032_cityHash64_for_decimal: [ OK ] 0.95 sec.
2026-07-15 21:24:53 01428_hash_set_nan_key: [ OK ] 1.04 sec.
2026-07-15 21:24:53 02982_unambiguous_alter_commands: [ OK ] 1.05 sec.
2026-07-15 21:24:54 02661_read_from_archive_targz: [ OK ] 31.71 sec.
2026-07-15 21:24:54 02889_print_pretty_type_names: [ OK ] 0.89 sec.
2026-07-15 21:24:55 02495_concat_with_separator: [ OK ] 3.16 sec.
2026-07-15 21:24:55 00605_intersections_aggregate_functions: [ OK ] 0.96 sec.
2026-07-15 21:24:56 00612_http_max_query_size_for_distributed: [ OK ] 1.40 sec.
2026-07-15 21:24:56 03222_datetime64_small_value_const: [ OK ] 3.26 sec.
2026-07-15 21:24:58 02998_to_milliseconds: [ OK ] 1.39 sec.
2026-07-15 21:24:59 01039_row_policy_dcl: [ OK ] 3.26 sec.
2026-07-15 21:24:59 01553_datetime64_comparison: [ OK ] 0.95 sec.
2026-07-15 21:24:59 00825_protobuf_format_persons: [ OK ] 22.40 sec.
2026-07-15 21:25:00 01030_limit_by_with_ties_error: [ OK ] 5.62 sec.
2026-07-15 21:25:00 01518_nullable_aggregate_states1: [ OK ] 1.22 sec.
2026-07-15 21:25:00 02470_suspicious_low_cardinality_msan: [ OK ] 1.30 sec.
2026-07-15 21:25:01 00805_round_down: [ OK ] 2.07 sec.
2026-07-15 21:25:01 00462_json_true_false_literals: [ OK ] 1.07 sec.
2026-07-15 21:25:02 01818_case_float_value_fangyc: [ OK ] 0.95 sec.
2026-07-15 21:25:03 02515_aggregate_functions_statistics: [ OK ] 2.54 sec.
2026-07-15 21:25:03 00098_1_union_all: [ OK ] 1.75 sec.
2026-07-15 21:25:04 00127_group_by_concat: [ OK ] 1.15 sec.
2026-07-15 21:25:05 00278_insert_already_sorted: [ OK ] 2.31 sec.
2026-07-15 21:25:06 01399_http_request_headers: [ OK ] 3.29 sec.
2026-07-15 21:25:06 02100_now64_types_bug: [ OK ] 1.10 sec.
2026-07-15 21:25:07 03447_grouping_sets_analyzer_const_columns: [ OK ] 1.21 sec.
2026-07-15 21:25:08 02915_input_table_function_in_subquery: [ OK ] 4.28 sec.
2026-07-15 21:25:10 01155_old_mutation_parts_to_do: [ OK ] 20.75 sec.
2026-07-15 21:25:10 02841_not_ready_set_constraints: [ OK ] 1.40 sec.
2026-07-15 21:25:10 01040_dictionary_invalidate_query_switchover_long: [ OK ] 22.82 sec.
2026-07-15 21:25:12 00825_http_header_query_id: [ OK ] 2.32 sec.
2026-07-15 21:25:13 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 5.03 sec.
2026-07-15 21:25:13 02456_bloom_filter_assert: [ OK ] 2.72 sec.
2026-07-15 21:25:13 01526_param_uuid: [ OK ] 3.02 sec.
2026-07-15 21:25:13 01259_datetime64_ubsan: [ OK ] 0.90 sec.
2026-07-15 21:25:14 01657_array_element_ubsan: [ OK ] 1.20 sec.
2026-07-15 21:25:14 03015_peder1001: [ OK ] 1.20 sec.
2026-07-15 21:25:14 02997_projections_formatting: [ OK ] 0.89 sec.
2026-07-15 21:25:14 02267_type_inference_for_insert_into_function_null: [ OK ] 1.15 sec.
2026-07-15 21:25:15 02764_index_analysis_fix: [ OK ] 0.95 sec.
2026-07-15 21:25:15 03016_analyzer_groupby_fuzz_59796: [ OK ] 1.00 sec.
2026-07-15 21:25:15 01685_json_extract_double_as_float: [ OK ] 1.10 sec.
2026-07-15 21:25:16 02353_translate: [ OK ] 1.39 sec.
2026-07-15 21:25:16 02220_array_join_format: [ OK ] 0.80 sec.
2026-07-15 21:25:17 03142_alter_comment_parameterized_view: [ OK ] 0.95 sec.
2026-07-15 21:25:17 00551_parse_or_null: [ OK ] 0.94 sec.
2026-07-15 21:25:17 01326_build_id: [ OK ] 0.89 sec.
2026-07-15 21:25:18 02184_storage_add_support_ttl: [ OK ] 1.71 sec.
2026-07-15 21:25:18 00997_extract_all_crash_6627: [ OK ] 0.84 sec.
2026-07-15 21:25:19 02956_fix_to_start_of_milli_microsecond: [ OK ] 1.06 sec.
2026-07-15 21:25:19 00497_whitespaces_in_insert: [ OK ] 13.60 sec.
2026-07-15 21:25:19 01960_lambda_precedence: [ OK ] 0.94 sec.
2026-07-15 21:25:21 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 21.01 sec.
2026-07-15 21:25:22 01531_query_log_query_comment: [ OK ] 5.14 sec.
2026-07-15 21:25:22 00437_nulls_first_last: [ OK ] 3.06 sec.
2026-07-15 21:25:23 02956_rocksdb_with_ttl: [ OK ] 4.02 sec.
2026-07-15 21:25:23 01034_with_fill_and_push_down_predicate: [ OK ] 0.94 sec.
2026-07-15 21:25:24 02002_sampling_and_unknown_column_bug: [ OK ] 0.94 sec.
2026-07-15 21:25:24 03001_bad_error_message_higher_order_functions: [ OK ] 3.13 sec.
2026-07-15 21:25:25 00800_versatile_storage_join: [ OK ] 2.06 sec.
2026-07-15 21:25:26 02129_window_functions_disable_optimizations: [ OK ] 1.19 sec.
2026-07-15 21:25:26 00308_write_buffer_valid_utf8: [ OK ] 0.80 sec.
2026-07-15 21:25:27 02354_vector_search_detach_attach: [ OK ] 1.05 sec.
2026-07-15 21:25:27 02594_msgpack_more_types: [ OK ] 3.37 sec.
2026-07-15 21:25:28 00370_duplicate_columns_in_subqueries: [ OK ] 1.35 sec.
2026-07-15 21:25:28 02354_vector_search_legacy_index_compatibility: [ OK ] 1.36 sec.
2026-07-15 21:25:28 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 8.93 sec.
2026-07-15 21:25:29 01072_select_constant_limit: [ OK ] 0.78 sec.
2026-07-15 21:25:29 00674_has_array_enum: [ OK ] 0.74 sec.
2026-07-15 21:25:30 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 2.26 sec.
2026-07-15 21:25:30 02844_max_backup_bandwidth_s3: [ OK ] 33.82 sec.
2026-07-15 21:25:30 02346_into_outfile_and_stdout: [ OK ] 8.22 sec.
2026-07-15 21:25:31 01069_materialized_view_alter_target_table: [ OK ] 1.26 sec.
2026-07-15 21:25:31 01544_errorCodeToName: [ OK ] 0.85 sec.
2026-07-15 21:25:31 02160_special_functions: [ OK ] 1.86 sec.
2026-07-15 21:25:31 00098_k_union_all: [ OK ] 0.84 sec.
2026-07-15 21:25:32 01655_agg_if_nullable: [ OK ] 1.26 sec.
2026-07-15 21:25:32 02716_int256_arrayfunc: [ OK ] 1.29 sec.
2026-07-15 21:25:32 01685_ssd_cache_dictionary_complex_key: [ OK ] 4.66 sec.
2026-07-15 21:25:33 00956_http_prepared_statements: [ OK ] 2.55 sec.
2026-07-15 21:25:33 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:25:33 Reason: not running for current build
2026-07-15 21:25:34 03164_parallel_replicas_range_filter_min_max: [ OK ] 2.75 sec.
2026-07-15 21:25:34 00662_has_nullable: [ OK ] 1.31 sec.
2026-07-15 21:25:35 02815_join_algorithm_setting: [ OK ] 4.12 sec.
2026-07-15 21:25:35 02708_dotProduct: [ OK ] 2.95 sec.
2026-07-15 21:25:35 01825_type_json_mutations: [ OK ] 1.48 sec.
2026-07-15 21:25:36 01925_map_populate_series_on_map: [ OK ] 1.86 sec.
2026-07-15 21:25:36 03161_cnf_reduction: [ OK ] 1.49 sec.
2026-07-15 21:25:36 02461_mullable_pk_monotonicity_bug: [ OK ] 2.96 sec.
2026-07-15 21:25:36 01558_enum_as_num_in_tsv_csv_input: [ OK ] 1.16 sec.
2026-07-15 21:25:37 02813_seriesDecomposeSTL: [ OK ] 1.30 sec.
2026-07-15 21:25:37 00632_aggregation_window_funnel: [ OK ] 4.62 sec.
2026-07-15 21:25:38 01599_multiline_input_and_singleline_comments: [ OK ] 1.39 sec.
2026-07-15 21:25:38 02864_statistics_delayed_materialization_in_merge: [ OK ] 1.56 sec.
2026-07-15 21:25:38 02346_fulltext_index_bug52019: [ OK ] 1.25 sec.
2026-07-15 21:25:39 02496_row_binary_large_string_size: [ OK ] 3.23 sec.
2026-07-15 21:25:39 00111_shard_external_sort_distributed: [ OK ] 92.07 sec.
2026-07-15 21:25:39 00028_shard_big_agg_aj_distributed: [ OK ] 1.47 sec.
2026-07-15 21:25:39 01050_engine_join_crash: [ OK ] 1.66 sec.
2026-07-15 21:25:39 01104_distributed_numbers_test: [ OK ] 1.32 sec.
2026-07-15 21:25:40 03152_analyzer_columns_list: [ OK ] 0.94 sec.
2026-07-15 21:25:40 00300_csv: [ OK ] 0.90 sec.
2026-07-15 21:25:40 02352_grouby_shadows_arg: [ OK ] 1.25 sec.
2026-07-15 21:25:40 00800_low_cardinality_empty_array: [ OK ] 0.86 sec.
2026-07-15 21:25:41 02187_test_final_and_limit_modifier: [ OK ] 0.90 sec.
2026-07-15 21:25:42 02251_alter_enum_nested_struct: [ OK ] 1.14 sec.
2026-07-15 21:25:42 00483_reading_from_array_structure: [ OK ] 1.14 sec.
2026-07-15 21:25:42 01511_different_expression_with_same_alias: [ OK ] 1.25 sec.
2026-07-15 21:25:42 03155_test_move_to_prewhere: [ OK ] 5.64 sec.
2026-07-15 21:25:43 03126_column_not_under_group_by: [ OK ] 0.89 sec.
2026-07-15 21:25:44 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.94 sec.
2026-07-15 21:25:45 01234_to_string_monotonic: [ OK ] 2.35 sec.
2026-07-15 21:25:45 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 3.56 sec.
2026-07-15 21:25:45 01135_default_and_alter_zookeeper: [ OK ] 1.45 sec.
2026-07-15 21:25:46 01470_columns_transformers: [ OK ] 4.61 sec.
2026-07-15 21:25:47 00129_quantile_timing_weighted: [ OK ] 1.78 sec.
2026-07-15 21:25:47 02160_h3_hex_area_Km2: [ OK ] 2.15 sec.
2026-07-15 21:25:47 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 1.83 sec.
2026-07-15 21:25:47 00698_validate_array_sizes_for_nested: [ OK ] 1.13 sec.
2026-07-15 21:25:48 02416_json_tuple_to_array_schema_inference: [ OK ] 0.86 sec.
2026-07-15 21:25:48 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.90 sec.
2026-07-15 21:25:49 01710_order_by_projections_incomplete: [ OK ] 1.17 sec.
2026-07-15 21:25:49 01505_log_distributed_deadlock: [ OK ] 0.99 sec.
2026-07-15 21:25:49 00742_require_join_strictness: [ OK ] 0.85 sec.
2026-07-15 21:25:50 01451_replicated_detach_drop_and_quorum_long: [ OK ] 2.66 sec.
2026-07-15 21:25:50 02346_to_hour_monotonicity_fix: [ OK ] 1.19 sec.
2026-07-15 21:25:50 02033_join_engine_deadlock_long: [ OK ] 8.75 sec.
2026-07-15 21:25:51 02813_array_agg: [ OK ] 1.05 sec.
2026-07-15 21:25:51 02559_add_parts: [ OK ] 1.40 sec.
2026-07-15 21:25:52 01600_encode_XML: [ OK ] 1.00 sec.
2026-07-15 21:25:53 02680_illegal_type_of_filter_projection: [ OK ] 1.14 sec.
2026-07-15 21:25:54 02538_analyzer_create_table_as_select: [ OK ] 0.99 sec.
2026-07-15 21:25:54 00608_uniq_array: [ OK ] 0.89 sec.
2026-07-15 21:25:55 00109_shard_totals_after_having: [ OK ] 5.59 sec.
2026-07-15 21:25:55 01914_ubsan_quantile_timing: [ OK ] 0.80 sec.
2026-07-15 21:25:56 00534_functions_bad_arguments12: [ OK ] 40.40 sec.
2026-07-15 21:25:57 01798_having_push_down: [ OK ] 1.90 sec.
2026-07-15 21:25:58 02124_insert_deduplication_token_replica: [ OK ] 2.41 sec.
2026-07-15 21:25:58 02122_parallel_formatting_JSONCompactStrings: [ OK ] 8.81 sec.
2026-07-15 21:25:59 01927_query_views_log_matview_exceptions: [ OK ] 19.37 sec.
2026-07-15 21:25:59 03196_max_intersections_arena_crash: [ OK ] 0.94 sec.
2026-07-15 21:25:59 00757_enum_defaults_const: [ OK ] 0.95 sec.
2026-07-15 21:26:00 02475_join_bug_42832: [ OK ] 1.24 sec.
2026-07-15 21:26:01 02871_clickhouse_client_restart_pager: [ OK ] 3.16 sec.
2026-07-15 21:26:01 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 1.15 sec.
2026-07-15 21:26:02 01868_order_by_fill_with_datetime64: [ OK ] 1.30 sec.
2026-07-15 21:26:05 01670_distributed_bytes_to_throw_insert: [ OK ] 3.23 sec.
2026-07-15 21:26:06 02907_fromDaysSinceYearZero: [ OK ] 5.52 sec.
2026-07-15 21:26:06 02713_array_low_cardinality_string: [ OK ] 1.15 sec.
2026-07-15 21:26:09 00909_arrayEnumerateUniq: [ OK ] 15.61 sec.
2026-07-15 21:26:10 00800_function_java_hash: [ OK ] 3.56 sec.
2026-07-15 21:26:10 00937_test_use_header_csv: [ OK ] 16.39 sec.
2026-07-15 21:26:11 02661_read_from_archive_tzst: [ OK ] 34.47 sec.
2026-07-15 21:26:11 00606_quantiles_and_nans: [ OK ] 1.10 sec.
2026-07-15 21:26:11 02789_jit_cannot_convert_column: [ OK ] 1.60 sec.
2026-07-15 21:26:11 00913_many_threads: [ OK ] 12.42 sec.
2026-07-15 21:26:11 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 1.15 sec.
2026-07-15 21:26:12 01259_combinator_distinct: [ OK ] 5.17 sec.
2026-07-15 21:26:12 01433_hex_float: [ OK ] 0.96 sec.
2026-07-15 21:26:12 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.84 sec.
2026-07-15 21:26:13 01532_having_with_totals: [ OK ] 1.60 sec.
2026-07-15 21:26:13 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 11.81 sec.
2026-07-15 21:26:14 02476_analyzer_join_with_unused_columns: [ OK ] 1.25 sec.
2026-07-15 21:26:14 00416_pocopatch_progress_in_http_headers: [ OK ] 3.33 sec.
2026-07-15 21:26:14 01475_fix_bigint_shift: [ OK ] 0.85 sec.
2026-07-15 21:26:15 01739_index_hint: [ OK ] 2.21 sec.
2026-07-15 21:26:15 01825_type_json_ghdata: [ OK ] 26.03 sec.
2026-07-15 21:26:15 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec.
2026-07-15 21:26:15 Reason: not running for current build
2026-07-15 21:26:15 00477_parsing_data_types: [ OK ] 0.74 sec.
2026-07-15 21:26:15 01921_with_fill_with_totals: [ OK ] 0.91 sec.
2026-07-15 21:26:16 00878_join_unexpected_results: [ OK ] 2.95 sec.
2026-07-15 21:26:16 02158_proportions_ztest: [ OK ] 1.05 sec.
2026-07-15 21:26:16 02680_datetime64_monotonic_check: [ OK ] 1.25 sec.
2026-07-15 21:26:16 03054_analyzer_join_alias: [ OK ] 0.85 sec.
2026-07-15 21:26:17 03162_dynamic_type_nested: [ OK ] 0.89 sec.
2026-07-15 21:26:17 03261_test_merge_parquet_bloom_filter_minmax_stats: [ OK ] 4.16 sec.
2026-07-15 21:26:17 00956_join_use_nulls_with_array_column: [ OK ] 1.04 sec.
2026-07-15 21:26:17 01345_array_join_LittleMaverick: [ OK ] 1.30 sec.
2026-07-15 21:26:18 02475_or_function_alias_and_const_where: [ OK ] 0.86 sec.
2026-07-15 21:26:18 02142_http_with_query_parameters: [ OK ] 2.26 sec.
2026-07-15 21:26:19 02025_nested_func_for_if_combinator: [ OK ] 1.17 sec.
2026-07-15 21:26:19 02345_analyzer_subqueries: [ OK ] 1.87 sec.
2026-07-15 21:26:20 03040_recursive_cte_postgres_6: [ OK ] 2.51 sec.
2026-07-15 21:26:20 01122_totals_rollup_having_block_header: [ OK ] 1.09 sec.
2026-07-15 21:26:22 02325_compatibility_setting_2: [ OK ] 1.25 sec.
2026-07-15 21:26:22 02012_compress_lz4: [ OK ] 3.81 sec.
2026-07-15 21:26:24 02482_insert_into_dist_race: [ OK ] 1.80 sec.
2026-07-15 21:26:26 03008_uniq_exact_equal_ranges: [ OK ] 8.50 sec.
2026-07-15 21:26:27 01292_quantile_array_bug: [ OK ] 0.84 sec.
2026-07-15 21:26:28 01054_random_printable_ascii_ubsan: [ OK ] 7.62 sec.
2026-07-15 21:26:28 02247_read_bools_as_numbers_json: [ OK ] 17.49 sec.
2026-07-15 21:26:29 00465_nullable_default: [ OK ] 0.79 sec.
2026-07-15 21:26:29 01086_window_view_cleanup: [ OK ] 13.01 sec.
2026-07-15 21:26:29 03003_compatibility_setting_bad_value: [ OK ] 0.68 sec.
2026-07-15 21:26:31 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 1.09 sec.
2026-07-15 21:26:31 02015_async_inserts_4: [ OK ] 14.25 sec.
2026-07-15 21:26:31 01529_bad_memory_tracking: [ OK ] 9.60 sec.
2026-07-15 21:26:32 01547_query_log_current_database: [ OK ] 2.50 sec.
2026-07-15 21:26:32 00980_crash_nullable_decimal: [ OK ] 0.94 sec.
2026-07-15 21:26:34 03001_block_offset_column: [ OK ] 2.61 sec.
2026-07-15 21:26:34 02800_clickhouse_local_default_settings: [ OK ] 2.65 sec.
2026-07-15 21:26:35 01427_pk_and_expression_with_different_type: [ OK ] 0.89 sec.
2026-07-15 21:26:35 01318_encrypt: [ OK ] 3.91 sec.
2026-07-15 21:26:36 01264_nested_baloo_bear: [ OK ] 1.05 sec.
2026-07-15 21:26:37 01660_join_or_inner: [ OK ] 1.91 sec.
2026-07-15 21:26:37 01460_mark_inclusion_search_crash: [ OK ] 1.05 sec.
2026-07-15 21:26:37 01666_date_lut_buffer_overflow: [ OK ] 0.74 sec.
2026-07-15 21:26:38 02933_sqid: [ OK ] 6.37 sec.
2026-07-15 21:26:39 01866_datetime64_cmp_with_constant: [ OK ] 2.10 sec.
2026-07-15 21:26:39 02843_backup_use_same_password_for_base_backup: [ OK ] 14.74 sec.
2026-07-15 21:26:40 00321_pk_set: [ OK ] 1.75 sec.
2026-07-15 21:26:40 01825_new_type_json_multiple_files: [ OK ] 12.97 sec.
2026-07-15 21:26:41 02803_backup_tmp_files: [ OK ] 5.68 sec.
2026-07-15 21:26:42 02510_group_by_prewhere_null: [ OK ] 1.21 sec.
2026-07-15 21:26:42 02049_clickhouse_local_merge_tree: [ OK ] 4.02 sec.
2026-07-15 21:26:42 02341_global_join_cte: [ OK ] 2.38 sec.
2026-07-15 21:26:42 01646_rewrite_sum_if: [ OK ] 3.15 sec.
2026-07-15 21:26:42 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.70 sec.
2026-07-15 21:26:42 01070_h3_to_parent: [ OK ] 0.79 sec.
2026-07-15 21:26:42 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.84 sec.
2026-07-15 21:26:44 02096_date_time_1970_saturation: [ OK ] 1.84 sec.
2026-07-15 21:26:44 02294_dictionaries_hierarchical_index: [ OK ] 2.26 sec.
2026-07-15 21:26:45 01926_union_all_schmak: [ OK ] 0.75 sec.
2026-07-15 21:26:45 02267_special_operator_parse_alias_check: [ OK ] 2.84 sec.
2026-07-15 21:26:46 01458_named_tuple_millin: [ OK ] 0.84 sec.
2026-07-15 21:26:47 02973_block_number_sparse_serialization_and_mutation: [ OK ] 2.36 sec.
2026-07-15 21:26:49 02900_clickhouse_local_drop_current_database: [ OK ] 2.45 sec.
2026-07-15 21:26:49 02895_peak_memory_usage_http_headers_regression: [ OK ] 3.20 sec.
2026-07-15 21:26:50 01273_arrow_nested_arrays_load: [ OK ] 7.83 sec.
2026-07-15 21:26:50 01097_pre_limit: [ OK ] 0.91 sec.
2026-07-15 21:26:51 02994_inconsistent_formatting: [ OK ] 1.08 sec.
2026-07-15 21:26:51 02932_group_by_null_fuzzer: [ OK ] 1.56 sec.
2026-07-15 21:26:52 03069_analyzer_with_alias_in_array_join: [ OK ] 0.77 sec.
2026-07-15 21:26:53 02293_h3_line: [ OK ] 1.87 sec.
2026-07-15 21:26:54 00534_functions_bad_arguments7: [ OK ] 42.55 sec.
2026-07-15 21:26:55 02916_replication_protocol_wait_for_part: [ OK ] 12.43 sec.
2026-07-15 21:26:55 02897_alter_partition_parameters: [ OK ] 4.12 sec.
2026-07-15 21:26:55 02921_fuzzbits_with_array_join: [ OK ] 0.85 sec.
2026-07-15 21:26:55 01926_order_by_desc_limit: [ OK ] 26.04 sec.
2026-07-15 21:26:55 01073_show_tables_not_like: [ OK ] 1.65 sec.
2026-07-15 21:26:56 00098_l_union_all: [ OK ] 1.06 sec.
2026-07-15 21:26:56 01013_hex_float: [ OK ] 1.20 sec.
2026-07-15 21:26:57 02890_untuple_column_names: [ OK ] 1.96 sec.
2026-07-15 21:26:57 00938_dataset_test: [ OK ] 1.23 sec.
2026-07-15 21:26:58 02042_map_get_non_const_key: [ OK ] 0.86 sec.
2026-07-15 21:26:58 01475_read_subcolumns_3: [ OK ] 2.20 sec.
2026-07-15 21:26:59 02246_is_secure_query_log: [ OK ] 18.54 sec.
2026-07-15 21:27:00 02382_analyzer_matcher_join_using: [ OK ] 2.56 sec.
2026-07-15 21:27:00 02479_nullable_primary_key_non_first_column: [ OK ] 1.29 sec.
2026-07-15 21:27:01 00996_limit_with_ties: [ OK ] 3.10 sec.
2026-07-15 21:27:01 01010_pmj_on_disk: [ OK ] 1.65 sec.
2026-07-15 21:27:02 02131_materialize_column_cast: [ OK ] 1.81 sec.
2026-07-15 21:27:02 01567_system_processes_current_database: [ OK ] 0.85 sec.
2026-07-15 21:27:02 00488_column_name_primary: [ OK ] 0.90 sec.
2026-07-15 21:27:03 02180_group_by_lowcardinality: [ OK ] 0.95 sec.
2026-07-15 21:27:03 01119_optimize_trivial_insert_select: [ OK ] 8.23 sec.
2026-07-15 21:27:04 03208_inconsistent_formatting_of_not_subquery: [ OK ] 2.16 sec.
2026-07-15 21:27:04 03208_uniq_with_empty_tuple: [ OK ] 0.81 sec.
2026-07-15 21:27:04 01882_total_rows_approx: [ OK ] 6.02 sec.
2026-07-15 21:27:05 02746_index_analysis_binary_operator_with_null: [ OK ] 0.95 sec.
2026-07-15 21:27:05 01001_enums_in_in_section: [ OK ] 0.89 sec.
2026-07-15 21:27:05 02982_parallel_replicas_unexpected_cluster: [ OK ] 1.11 sec.
2026-07-15 21:27:05 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 2.45 sec.
2026-07-15 21:27:06 02493_analyzer_sum_if_to_count_if: [ OK ] 1.00 sec.
2026-07-15 21:27:06 00038_totals_limit: [ OK ] 0.79 sec.
2026-07-15 21:27:07 01942_dateTimeToSnowflake: [ OK ] 1.62 sec.
2026-07-15 21:27:07 00676_group_by_in: [ OK ] 1.04 sec.
2026-07-15 21:27:08 03150_url_hash_non_constant_level: [ OK ] 1.11 sec.
2026-07-15 21:27:08 02764_parallel_replicas_plain_merge_tree: [ OK ] 1.40 sec.
2026-07-15 21:27:08 02136_scalar_progress: [ OK ] 2.30 sec.
2026-07-15 21:27:10 01865_aggregator_overflow_row: [ OK ] 1.65 sec.
2026-07-15 21:27:11 01143_trivial_count_with_join: [ OK ] 0.95 sec.
2026-07-15 21:27:13 02456_async_inserts_logs: [ OK ] 10.13 sec.
2026-07-15 21:27:13 00937_format_schema_rows_template: [ OK ] 7.48 sec.
2026-07-15 21:27:15 02207_s3_content_type: [ OK ] 4.10 sec.
2026-07-15 21:27:16 00952_insert_into_distributed_with_materialized_column: [ OK ] 3.60 sec.
2026-07-15 21:27:18 03039_unknown_identifier_window_function: [ OK ] 1.13 sec.
2026-07-15 21:27:19 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 1.20 sec.
2026-07-15 21:27:26 01358_lc_parquet: [ OK ] 17.72 sec.
2026-07-15 21:27:33 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 20.55 sec.
2026-07-15 21:27:34 01662_join_mixed: [ OK ] 1.05 sec.
2026-07-15 21:27:36 00534_functions_bad_arguments4_long: [ OK ] 40.84 sec.
2026-07-15 21:27:36 02439_merge_selecting_partitions: [ OK ] 9.94 sec.
2026-07-15 21:27:37 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.89 sec.
2026-07-15 21:27:37 01471_with_format: [ OK ] 0.80 sec.
2026-07-15 21:27:38 01388_multi_if_optimization: [ OK ] 0.95 sec.
2026-07-15 21:27:39 02560_vertical_merge_memory_usage: [ OK ] 20.44 sec.
2026-07-15 21:27:40 01496_signedness_conversion_monotonicity: [ OK ] 0.89 sec.
2026-07-15 21:27:41 01273_arrow_decimal: [ OK ] 6.11 sec.
2026-07-15 21:27:44 02136_scalar_read_rows_json: [ OK ] 3.35 sec.
2026-07-15 21:27:44 02421_truncate_isolation_with_mutations: [ OK ] 53.26 sec.
2026-07-15 21:27:44 00411_long_accurate_number_comparison_int4: [ OK ] 28.95 sec.
2026-07-15 21:27:45 02280_add_query_level_settings: [ OK ] 1.09 sec.
2026-07-15 21:27:45 02792_alter_table_modify_comment: [ OK ] 4.25 sec.
2026-07-15 21:27:45 02705_grouping_keys_equal_keys: [ OK ] 0.84 sec.
2026-07-15 21:27:45 02111_global_context_temporary_tables: [ OK ] 0.89 sec.
2026-07-15 21:27:46 01123_parse_date_time_best_effort_even_more: [ OK ] 0.90 sec.
2026-07-15 21:27:46 03032_save_bad_json_escape_sequences: [ OK ] 0.73 sec.
2026-07-15 21:27:46 00195_shard_union_all_and_global_in: [ OK ] 1.25 sec.
2026-07-15 21:27:47 03203_optimize_disjunctions_chain_to_in: [ OK ] 1.00 sec.
2026-07-15 21:27:47 03032_rmt_create_columns_from_replica: [ OK ] 0.95 sec.
2026-07-15 21:27:48 00931_low_cardinality_read_with_empty_array: [ OK ] 2.25 sec.
2026-07-15 21:27:48 01825_type_json_in_other_types: [ OK ] 9.88 sec.
2026-07-15 21:27:48 02189_join_type_conversion: [ OK ] 0.79 sec.
2026-07-15 21:27:49 01549_low_cardinality_materialized_view: [ OK ] 1.09 sec.
2026-07-15 21:27:49 02842_suggest_http_page_in_error_message: [ OK ] 2.05 sec.
2026-07-15 21:27:50 02346_position_countsubstrings_zero_byte: [ OK ] 1.44 sec.
2026-07-15 21:27:50 02674_trivial_count_analyzer: [ OK ] 1.95 sec.
2026-07-15 21:27:50 03290_final_collapsing: [ OK ] 1.40 sec.
2026-07-15 21:27:52 01305_polygons_union: [ OK ] 1.49 sec.
2026-07-15 21:27:52 01603_read_with_backoff_bug: [ OK ] 66.92 sec.
2026-07-15 21:27:53 01353_neighbor_overflow: [ OK ] 0.93 sec.
2026-07-15 21:27:53 01675_distributed_bytes_to_delay_insert: [ OK ] 7.32 sec.
2026-07-15 21:27:53 02955_analyzer_using_functional_args: [ OK ] 5.26 sec.
2026-07-15 21:27:55 01213_alter_rename_nested: [ OK ] 1.39 sec.
2026-07-15 21:27:55 02242_make_date_mysql: [ OK ] 1.44 sec.
2026-07-15 21:27:56 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 18.70 sec.
2026-07-15 21:27:56 02721_parquet_field_not_found: [ OK ] 2.85 sec.
2026-07-15 21:27:56 02941_variant_type_1: [ OK ] 47.91 sec.
2026-07-15 21:27:57 02923_join_use_nulls_modulo: [ OK ] 0.79 sec.
2026-07-15 21:27:57 01746_long_zlib_http_compression_json_format: [ OK ] 2.39 sec.
2026-07-15 21:27:58 01674_clickhouse_client_query_param_cte: [ OK ] 2.59 sec.
2026-07-15 21:27:58 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.99 sec.
2026-07-15 21:27:58 00637_sessions_in_http_interface_and_settings: [ OK ] 2.09 sec.
2026-07-15 21:27:58 02324_map_combinator_bug: [ OK ] 1.44 sec.
2026-07-15 21:27:58 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.76 sec.
2026-07-15 21:27:59 03169_display_column_names_in_footer: [ OK ] 1.60 sec.
2026-07-15 21:28:00 02834_timestamp_function: [ OK ] 1.39 sec.
2026-07-15 21:28:00 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 1.64 sec.
2026-07-15 21:28:00 00623_replicated_truncate_table_zookeeper_long: [ OK ] 1.96 sec.
2026-07-15 21:28:00 02770_jit_aggregation_nullable_key_fix: [ OK ] 2.70 sec.
2026-07-15 21:28:01 00897_flatten: [ OK ] 1.04 sec.
2026-07-15 21:28:01 01421_array_nullable_element_nullable_index: [ OK ] 0.79 sec.
2026-07-15 21:28:02 01767_timezoneOf: [ OK ] 2.61 sec.
2026-07-15 21:28:03 02476_fuse_sum_count: [ OK ] 1.75 sec.
2026-07-15 21:28:04 03008_deduplication_insert_into_partitioned_table: [ OK ] 4.42 sec.
2026-07-15 21:28:05 01451_replicated_detach_drop_part_long: [ OK ] 2.29 sec.
2026-07-15 21:28:05 00234_disjunctive_equality_chains_optimization: [ OK ] 0.84 sec.
2026-07-15 21:28:06 00653_monotonic_integer_cast: [ OK ] 0.94 sec.
2026-07-15 21:28:07 03199_fix_auc_tie_handling: [ OK ] 1.50 sec.
2026-07-15 21:28:09 02572_query_views_log_background_thread: [ OK ] 18.93 sec.
2026-07-15 21:28:09 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 4.12 sec.
2026-07-15 21:28:09 02466_distributed_query_profiler: [ OK ] 1.76 sec.
2026-07-15 21:28:09 02357_query_cancellation_race: [ OK ] 8.73 sec.
2026-07-15 21:28:09 00484_preferred_max_column_in_block_size_bytes: [ OK ] 7.38 sec.
2026-07-15 21:28:10 00580_consistent_hashing_functions: [ OK ] 0.83 sec.
2026-07-15 21:28:10 01700_point_in_polygon_ubsan: [ OK ] 0.89 sec.
2026-07-15 21:28:10 02560_count_digits: [ OK ] 1.24 sec.
2026-07-15 21:28:11 01170_alter_partition_isolation: [ OK ] 11.31 sec.
2026-07-15 21:28:12 02887_tuple_element_distributed: [ OK ] 1.01 sec.
2026-07-15 21:28:12 03062_analyzer_join_engine_missing_column: [ OK ] 1.44 sec.
2026-07-15 21:28:12 01925_jit_aggregation_function_count_long: [ OK ] 1.80 sec.
2026-07-15 21:28:13 01421_assert_in_in: [ OK ] 0.97 sec.
2026-07-15 21:28:13 01037_zookeeper_check_table_empty_pk: [ OK ] 1.65 sec.
2026-07-15 21:28:14 01470_explain: [ OK ] 0.91 sec.
2026-07-15 21:28:15 01623_byte_size_const: [ OK ] 1.07 sec.
2026-07-15 21:28:15 01281_parseDateTime64BestEffort: [ OK ] 2.62 sec.
2026-07-15 21:28:16 00688_low_cardinality_defaults: [ OK ] 0.96 sec.
2026-07-15 21:28:17 01339_client_unrecognized_option: [ OK ] 3.67 sec.
2026-07-15 21:28:17 03033_create_as_copies_comment: [ OK ] 1.00 sec.
2026-07-15 21:28:18 00836_indices_alter_replicated_zookeeper_long: [ OK ] 5.89 sec.
2026-07-15 21:28:19 02732_rename_after_processing: [ OK ] 9.57 sec.
2026-07-15 21:28:19 00739_array_element_nullable_string_mattrobenolt: [ OK ] 1.09 sec.
2026-07-15 21:28:20 02875_json_array_as_string: [ OK ] 0.84 sec.
2026-07-15 21:28:20 02337_check_translate_qualified_names_matcher: [ OK ] 0.75 sec.
2026-07-15 21:28:21 01710_projection_with_column_transformers: [ OK ] 0.90 sec.
2026-07-15 21:28:21 03127_argMin_combinator_state: [ OK ] 1.46 sec.
2026-07-15 21:28:22 01871_merge_tree_compile_expressions: [ OK ] 4.61 sec.
2026-07-15 21:28:22 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 6.94 sec.
2026-07-15 21:28:23 02478_window_frame_type_groups: [ OK ] 1.05 sec.
2026-07-15 21:28:23 02524_fuzz_and_fuss: [ OK ] 1.03 sec.
2026-07-15 21:28:23 02293_ttest_large_samples: [ OK ] 14.08 sec.
2026-07-15 21:28:23 00942_dataparts_500: [ OK ] 2.39 sec.
2026-07-15 21:28:24 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 1.10 sec.
2026-07-15 21:28:24 02507_to_unix_timestamp_overflow: [ OK ] 1.05 sec.
2026-07-15 21:28:24 00450_higher_order_and_nullable: [ OK ] 0.90 sec.
2026-07-15 21:28:24 02050_clickhouse_local_parsing_exception: [ OK ] 2.82 sec.
2026-07-15 21:28:25 01785_pmj_lc_bug: [ OK ] 1.46 sec.
2026-07-15 21:28:25 02901_remove_nullable_crash_analyzer: [ OK ] 1.15 sec.
2026-07-15 21:28:25 02151_lc_prefetch: [ SKIPPED ] 0.00 sec.
2026-07-15 21:28:25 Reason: not running for current build
2026-07-15 21:28:26 02294_decimal_second_errors: [ OK ] 0.89 sec.
2026-07-15 21:28:26 03148_async_queries_in_query_log_errors: [ OK ] 9.31 sec.
2026-07-15 21:28:26 01710_normal_projection_format: [ OK ] 0.94 sec.
2026-07-15 21:28:27 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 29.19 sec.
2026-07-15 21:28:27 01262_low_cardinality_remove: [ OK ] 1.50 sec.
2026-07-15 21:28:27 02203_shebang: [ OK ] 2.86 sec.
2026-07-15 21:28:28 00560_float_leading_plus_in_exponent: [ OK ] 0.93 sec.
2026-07-15 21:28:29 02020_exponential_smoothing: [ OK ] 5.08 sec.
2026-07-15 21:28:29 02491_part_log_has_table_uuid: [ OK ] 2.76 sec.
2026-07-15 21:28:29 00507_array_no_params: [ OK ] 4.83 sec.
2026-07-15 21:28:29 02494_array_function_range: [ OK ] 1.09 sec.
2026-07-15 21:28:30 01303_polygons_equals: [ OK ] 0.86 sec.
2026-07-15 21:28:30 00060_date_lut: [ OK ] 0.84 sec.
2026-07-15 21:28:30 03144_fuzz_quoted_type_name: [ OK ] 0.89 sec.
2026-07-15 21:28:30 03201_avro_negative_block_size_arrays: [ OK ] 3.21 sec.
2026-07-15 21:28:31 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 1.30 sec.
2026-07-15 21:28:31 03038_nested_dynamic_merges_compact_horizontal: [ SKIPPED ] 0.00 sec.
2026-07-15 21:28:31 Reason: not running for current build
2026-07-15 21:28:31 02705_projection_and_ast_optimizations_bug: [ OK ] 1.21 sec.
2026-07-15 21:28:31 02674_date_int_string_json_inference: [ OK ] 0.91 sec.
2026-07-15 21:28:33 02771_jit_functions_comparison_crash: [ OK ] 1.15 sec.
2026-07-15 21:28:34 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 3.72 sec.
2026-07-15 21:28:34 00609_prewhere_and_default: [ OK ] 2.96 sec.
2026-07-15 21:28:34 02960_alter_table_part_query_parameter: [ OK ] 1.15 sec.
2026-07-15 21:28:34 03156_group_concat: [ OK ] 3.43 sec.
2026-07-15 21:28:37 02345_filesystem_local: [ OK ] 2.85 sec.
2026-07-15 21:28:37 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 2.73 sec.
2026-07-15 21:28:37 02730_with_fill_by_sorting_prefix: [ OK ] 2.72 sec.
2026-07-15 21:28:38 02006_use_constants_in_with_and_select: [ OK ] 1.12 sec.
2026-07-15 21:28:40 02373_datetime64_monotonicity: [ OK ] 12.93 sec.
2026-07-15 21:28:40 01293_client_interactive_vertical_singleline: [ OK ] 3.42 sec.
2026-07-15 21:28:40 03198_orc_read_time_zone: [ OK ] 6.36 sec.
2026-07-15 21:28:41 01073_bad_alter_partition: [ OK ] 1.30 sec.
2026-07-15 21:28:41 01710_normal_projection_with_query_plan_optimization: [ OK ] 1.35 sec.
2026-07-15 21:28:41 02973_parse_crlf_with_tsv_files: [ OK ] 4.62 sec.
2026-07-15 21:28:42 01797_StripeLog_rwlock_ub: [ OK ] 0.94 sec.
2026-07-15 21:28:43 01402_cast_nullable_string_to_enum: [ OK ] 1.09 sec.
2026-07-15 21:28:43 01852_hints_enum_name: [ OK ] 2.96 sec.
2026-07-15 21:28:43 02923_cte_equality_disjunction: [ OK ] 0.84 sec.
2026-07-15 21:28:44 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.84 sec.
2026-07-15 21:28:44 01115_prewhere_array_join: [ OK ] 2.43 sec.
2026-07-15 21:28:44 03008_index_small: [ OK ] 1.20 sec.
2026-07-15 21:28:44 02476_fix_cast_parser_bug: [ OK ] 0.79 sec.
2026-07-15 21:28:44 01338_long_select_and_alter: [ OK ] 17.98 sec.
2026-07-15 21:28:45 00267_tuple_array_access_operators_priority: [ OK ] 0.79 sec.
2026-07-15 21:28:45 00999_test_skip_indices_with_alter_and_merge: [ OK ] 1.19 sec.
2026-07-15 21:28:46 02692_multiple_joins_unicode: [ OK ] 1.22 sec.
2026-07-15 21:28:46 02771_skip_empty_files: [ OK ] 8.39 sec.
2026-07-15 21:28:47 01302_polygons_distance: [ OK ] 1.10 sec.
2026-07-15 21:28:47 01825_new_type_json_in_array: [ OK ] 3.15 sec.
2026-07-15 21:28:48 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 1.90 sec.
2026-07-15 21:28:49 01943_query_id_check: [ OK ] 5.01 sec.
2026-07-15 21:28:50 00331_final_and_prewhere: [ OK ] 1.04 sec.
2026-07-15 21:28:52 01786_group_by_pk_many_streams: [ OK ] 2.14 sec.
2026-07-15 21:28:53 02815_no_throw_in_simple_queries: [ FAIL ] 5.57 sec.
2026-07-15 21:28:53 Reason: return code: 1
2026-07-15 21:28:53 expect: spawn id exp3 not open
2026-07-15 21:28:53 while executing
2026-07-15 21:28:53 "expect ":) ""
2026-07-15 21:28:53 , result:
2026-07-15 21:28:53
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53
2026-07-15 21:28:53 stdout:
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53 Failed
2026-07-15 21:28:53
2026-07-15 21:28:53
2026-07-15 21:28:53 Settings used in the test: --max_insert_threads 2 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 0 --fsync_metadata 1 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 5446243 --max_read_buffer_size 533366 --prefer_localhost_replica 0 --max_block_size 37107 --max_joined_block_size_rows 77042 --max_threads 2 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 14 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 18403891 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 502794836 --min_bytes_to_use_mmap_io 1 --local_filesystem_read_method pread --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 30 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 872009664 --min_compress_block_size 7556 --max_compress_block_size 1747707 --merge_tree_compact_parts_min_granules_to_multibuffer_read 58 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 2496751 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.05 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 100000000 --min_external_table_block_size_bytes 1 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 0
2026-07-15 21:28:53
2026-07-15 21:28:53 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.8938243756313193 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1000000 --vertical_merge_algorithm_min_columns_to_activate 100 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 11010726 --merge_max_block_size 1466 --index_granularity 18042 --min_bytes_for_wide_part 1019282191 --marks_compress_block_size 42051 --primary_key_compress_block_size 49587 --replace_long_file_name_to_hash 0 --max_file_name_length 2 --min_bytes_for_full_part_storage 468123578 --compact_parts_max_bytes_to_buffer 343680863 --compact_parts_max_granules_to_buffer 62 --compact_parts_merge_max_bytes_to_prefetch_part 19265726 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 0 --old_parts_lifetime 459
2026-07-15 21:28:53
2026-07-15 21:28:53 Database: test_it773nbi
2026-07-15 21:28:53 00700_to_decimal_or_something_1: [ OK ] 4.67 sec.
2026-07-15 21:28:54 03210_nested_short_circuit_functions_bug: [ OK ] 0.83 sec.
2026-07-15 21:28:54 02229_client_stop_multiquery_in_SIGINT: [ OK ] 9.30 sec.
2026-07-15 21:28:55 03210_empty_tuple_lhs_of_in: [ OK ] 0.84 sec.
2026-07-15 21:28:55 00846_join_using_tuple_crash: [ OK ] 0.89 sec.
2026-07-15 21:28:56 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.84 sec.
2026-07-15 21:28:56 01544_file_engine_settings: [ OK ] 3.45 sec.
2026-07-15 21:28:56 01671_aggregate_function_group_bitmap_data: [ OK ] 1.14 sec.
2026-07-15 21:28:57 00357_to_string_complex_types: [ OK ] 1.04 sec.
2026-07-15 21:28:59 01268_mv_scalars: [ OK ] 2.56 sec.
2026-07-15 21:28:59 02963_remote_read_small_buffer_size_bug: [ OK ] 27.33 sec.
2026-07-15 21:29:00 01560_optimize_on_insert_zookeeper: [ OK ] 2.52 sec.
2026-07-15 21:29:00 02241_short_circuit_short_column: [ OK ] 0.90 sec.
2026-07-15 21:29:00 02539_generate_random_ip: [ OK ] 0.85 sec.
2026-07-15 21:29:01 01424_parse_date_time_bad_date: [ OK ] 1.00 sec.
2026-07-15 21:29:02 00914_replicate: [ OK ] 0.84 sec.
2026-07-15 21:29:02 02861_join_on_nullsafe_compare: [ OK ] 5.48 sec.
2026-07-15 21:29:02 02374_analyzer_array_join: [ OK ] 2.27 sec.
2026-07-15 21:29:02 00287_column_const_with_nan: [ OK ] 0.80 sec.
2026-07-15 21:29:03 00298_enum_width_and_cast: [ OK ] 1.19 sec.
2026-07-15 21:29:03 03274_format_inference_create_query_file: [ OK ] 3.16 sec.
2026-07-15 21:29:04 01784_parallel_formatting_memory: [ OK ] 1.24 sec.
2026-07-15 21:29:04 02310_generate_multi_columns_with_uuid: [ OK ] 0.89 sec.
2026-07-15 21:29:05 01497_alias_on_default_array: [ OK ] 0.94 sec.
2026-07-15 21:29:06 01034_move_partition_from_table_zookeeper: [ OK ] 75.46 sec.
2026-07-15 21:29:06 01533_distinct_depends_on_max_threads: [ OK ] 3.21 sec.
2026-07-15 21:29:07 01593_insert_settings: [ OK ] 2.37 sec.
2026-07-15 21:29:07 02096_bad_options_in_client_and_local: [ OK ] 5.28 sec.
2026-07-15 21:29:08 00159_whitespace_in_columns_list: [ OK ] 1.05 sec.
2026-07-15 21:29:08 00875_join_right_nulls_ors: [ OK ] 2.00 sec.
2026-07-15 21:29:08 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 2.22 sec.
2026-07-15 21:29:09 03200_memory_engine_alter_dynamic: [ OK ] 1.10 sec.
2026-07-15 21:29:09 02918_analyzer_to_ast_crash: [ OK ] 0.90 sec.
2026-07-15 21:29:09 01544_fromModifiedJulianDay: [ OK ] 1.52 sec.
2026-07-15 21:29:10 02206_format_override: [ OK ] 4.89 sec.
2026-07-15 21:29:10 01251_string_comparison: [ OK ] 0.89 sec.
2026-07-15 21:29:10 01748_partition_id_pruning: [ OK ] 1.55 sec.
2026-07-15 21:29:10 01585_use_index_for_global_in: [ OK ] 1.39 sec.
2026-07-15 21:29:11 02255_broken_parts_chain_on_start: [ OK ] 17.86 sec.
2026-07-15 21:29:11 01938_joins_identifiers: [ OK ] 1.14 sec.
2026-07-15 21:29:12 01715_table_function_view_fix: [ OK ] 0.85 sec.
2026-07-15 21:29:12 01681_bloom_filter_nullable_column: [ OK ] 2.07 sec.
2026-07-15 21:29:12 02999_scalar_subqueries_bug_1: [ OK ] 1.41 sec.
2026-07-15 21:29:13 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 1.30 sec.
2026-07-15 21:29:13 02982_dont_infer_exponent_floats: [ OK ] 0.84 sec.
2026-07-15 21:29:14 03042_not_found_column_c1: [ OK ] 0.90 sec.
2026-07-15 21:29:14 00619_union_highlite: [ OK ] 1.07 sec.
2026-07-15 21:29:15 01545_url_file_format_settings: [ OK ] 1.35 sec.
2026-07-15 21:29:16 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 1.21 sec.
2026-07-15 21:29:17 01825_new_type_json_insert_select: [ OK ] 3.43 sec.
2026-07-15 21:29:18 01714_alter_drop_version: [ OK ] 1.20 sec.
2026-07-15 21:29:18 01119_session_log: [ OK ] 33.73 sec.
2026-07-15 21:29:19 02867_null_lc_in_bug: [ OK ] 1.30 sec.
2026-07-15 21:29:19 02841_not_ready_set_bug: [ OK ] 9.12 sec.
2026-07-15 21:29:19 00725_join_on_bug_2: [ OK ] 1.71 sec.
2026-07-15 21:29:20 02006_todatetime64_from_string: [ OK ] 1.17 sec.
2026-07-15 21:29:20 02128_apply_lambda_parsing: [ OK ] 1.10 sec.
2026-07-15 21:29:21 00818_alias_bug_4110: [ OK ] 1.87 sec.
2026-07-15 21:29:21 02228_merge_tree_insert_memory_usage: [ OK ] 9.29 sec.
2026-07-15 21:29:22 00396_uuid: [ OK ] 1.57 sec.
2026-07-15 21:29:22 02982_create_mv_inner_extra: [ OK ] 1.35 sec.
2026-07-15 21:29:23 00720_with_cube: [ OK ] 2.02 sec.
2026-07-15 21:29:23 00672_arrayDistinct: [ OK ] 1.35 sec.
2026-07-15 21:29:23 00324_hashing_enums: [ OK ] 0.99 sec.
2026-07-15 21:29:24 03146_bug47862: [ OK ] 0.94 sec.
2026-07-15 21:29:26 03150_grouping_sets_use_nulls_pushdown: [ OK ] 2.16 sec.
2026-07-15 21:29:27 00829_bitmap64_function: [ OK ] 3.12 sec.
2026-07-15 21:29:28 02015_async_inserts_7: [ OK ] 6.27 sec.
2026-07-15 21:29:28 02233_optimize_aggregation_in_order_prefix: [ OK ] 1.77 sec.
2026-07-15 21:29:28 01009_global_array_join_names: [ OK ] 1.26 sec.
2026-07-15 21:29:29 02578_ipv4_codec_t64: [ OK ] 0.95 sec.
2026-07-15 21:29:29 01600_min_max_compress_block_size: [ OK ] 1.04 sec.
2026-07-15 21:29:29 00934_is_valid_utf8: [ OK ] 5.94 sec.
2026-07-15 21:29:29 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec.
2026-07-15 21:29:29 Reason: not running for current build
2026-07-15 21:29:29 02675_predicate_push_down_filled_join_fix: [ OK ] 1.43 sec.
2026-07-15 21:29:30 02783_date_predicate_optimizations: [ OK ] 11.59 sec.
2026-07-15 21:29:30 00157_aliases_and_lambda_formal_parameters: [ OK ] 1.07 sec.
2026-07-15 21:29:30 00508_materialized_view_to: [ OK ] 1.41 sec.
2026-07-15 21:29:31 01386_negative_float_constant_key_condition: [ OK ] 1.35 sec.
2026-07-15 21:29:31 01428_h3_range_check: [ OK ] 1.05 sec.
2026-07-15 21:29:31 00740_optimize_predicate_expression: [ OK ] 1.27 sec.
2026-07-15 21:29:32 01356_initialize_aggregation: [ OK ] 1.00 sec.
2026-07-15 21:29:32 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 20.39 sec.
2026-07-15 21:29:33 01615_two_args_function_index_fix: [ OK ] 1.00 sec.
2026-07-15 21:29:33 01440_big_int_exotic_casts: [ OK ] 3.10 sec.
2026-07-15 21:29:34 02380_analyzer_join_sample: [ OK ] 1.16 sec.
2026-07-15 21:29:34 01032_duplicate_column_insert_query: [ OK ] 1.10 sec.
2026-07-15 21:29:35 01458_is_decimal_overflow: [ OK ] 1.92 sec.
2026-07-15 21:29:35 00697_in_subquery_shard: [ OK ] 3.21 sec.
2026-07-15 21:29:36 00618_nullable_in: [ OK ] 1.06 sec.
2026-07-15 21:29:37 02963_single_value_destructor: [ OK ] 2.76 sec.
2026-07-15 21:29:37 03034_recursive_cte_tree: [ OK ] 1.48 sec.
2026-07-15 21:29:37 00700_decimal_complex_types: [ OK ] 7.92 sec.
2026-07-15 21:29:38 01245_limit_infinite_sources: [ OK ] 1.76 sec.
2026-07-15 21:29:39 02392_every_setting_must_have_documentation: [ OK ] 1.06 sec.
2026-07-15 21:29:40 00154_shard_distributed_with_distinct: [ OK ] 1.58 sec.
2026-07-15 21:29:40 00033_fixed_string_to_string: [ OK ] 1.23 sec.
2026-07-15 21:29:41 01273_arrow_stream: [ OK ] 53.18 sec.
2026-07-15 21:29:41 00999_join_on_expression: [ OK ] 4.30 sec.
2026-07-15 21:29:41 01060_defaults_all_columns: [ OK ] 1.27 sec.
2026-07-15 21:29:42 00743_limit_by_not_found_column: [ OK ] 1.50 sec.
2026-07-15 21:29:43 02864_filtered_url_with_globs: [ OK ] 1.80 sec.
2026-07-15 21:29:44 03215_validate_type_in_alter_add_modify_column: [ OK ] 2.45 sec.
2026-07-15 21:29:45 00688_low_cardinality_syntax: [ OK ] 3.91 sec.
2026-07-15 21:29:47 02343_aggregation_pipeline: [ OK ] 4.60 sec.
2026-07-15 21:29:47 01954_clickhouse_benchmark_multiple_long: [ OK ] 37.52 sec.
2026-07-15 21:29:48 00022_func_higher_order_and_constants: [ OK ] 1.00 sec.
2026-07-15 21:29:48 01354_order_by_tuple_collate_const: [ OK ] 1.11 sec.
2026-07-15 21:29:48 01055_compact_parts_1: [ OK ] 2.03 sec.
2026-07-15 21:29:50 01720_engine_file_empty_if_not_exists: [ OK ] 1.30 sec.
2026-07-15 21:29:50 03321_functions_to_subcolumns_skip_index: [ OK ] 1.86 sec.
2026-07-15 21:29:50 01834_alias_columns_laziness_filimonov: [ OK ] 6.03 sec.
2026-07-15 21:29:51 01804_uniq_up_to_ubsan: [ OK ] 1.06 sec.
2026-07-15 21:29:51 02244_make_datetime: [ OK ] 3.16 sec.
2026-07-15 21:29:52 01851_s2_to_geo: [ OK ] 1.04 sec.
2026-07-15 21:29:52 01626_cnf_test: [ OK ] 1.72 sec.
2026-07-15 21:29:53 02013_emptystring_cast: [ OK ] 2.02 sec.
2026-07-15 21:29:54 01189_create_as_table_as_table_function: [ OK ] 0.97 sec.
2026-07-15 21:29:55 01781_merge_tree_deduplication: [ OK ] 11.90 sec.
2026-07-15 21:29:55 02737_arrayJaccardIndex: [ OK ] 2.89 sec.
2026-07-15 21:29:55 02377_optimize_sorting_by_input_stream_properties: [ OK ] 3.53 sec.
2026-07-15 21:29:56 01455_nullable_type_with_if_agg_combinator: [ OK ] 1.47 sec.
2026-07-15 21:29:57 01780_column_sparse_filter: [ OK ] 2.53 sec.
2026-07-15 21:29:57 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 2.63 sec.
2026-07-15 21:29:57 03167_parametrized_view_with_cte: [ OK ] 1.35 sec.
2026-07-15 21:29:58 00215_primary_key_order_zookeeper_long: [ OK ] 2.23 sec.
2026-07-15 21:29:59 00120_join_and_group_by: [ OK ] 1.25 sec.
2026-07-15 21:30:02 02233_interpolate_1: [ OK ] 4.84 sec.
2026-07-15 21:30:02 00084_summing_merge_tree: [ OK ] 3.60 sec.
2026-07-15 21:30:03 00612_union_query_with_subquery: [ OK ] 1.32 sec.
2026-07-15 21:30:04 01614_with_fill_with_limit: [ OK ] 1.17 sec.
2026-07-15 21:30:05 01052_array_reduce_exception: [ OK ] 0.87 sec.
2026-07-15 21:30:05 02493_analyzer_table_functions_untuple: [ OK ] 1.66 sec.
2026-07-15 21:30:06 00417_kill_query: [ OK ] 8.63 sec.
2026-07-15 21:30:06 03230_anyHeavy_merge: [ OK ] 1.05 sec.
2026-07-15 21:30:10 00688_low_cardinality_serialization: [ OK ] 18.91 sec.
2026-07-15 21:30:10 02992_all_columns_should_have_comment: [ OK ] 3.83 sec.
2026-07-15 21:30:10 02370_lost_part_intersecting_merges: [ OK ] 33.51 sec.
2026-07-15 21:30:10 02875_parallel_replicas_cluster_all_replicas: [ OK ] 12.59 sec.
2026-07-15 21:30:10 02046_low_cardinality_parallel_group_by: [ OK ] 36.61 sec.
2026-07-15 21:30:11 01773_datetime64_add_ubsan: [ OK ] 0.74 sec.
2026-07-15 21:30:12 03095_merge_and_buffer_tables: [ OK ] 1.80 sec.
2026-07-15 21:30:12 02916_distributed_skip_unavailable_shards: [ OK ] 2.11 sec.
2026-07-15 21:30:13 01528_to_uuid_or_null_or_zero: [ OK ] 1.70 sec.
2026-07-15 21:30:14 00065_shard_float_literals_formatting: [ OK ] 1.29 sec.
2026-07-15 21:30:14 01825_new_type_json_parallel_insert: [ OK ] 3.47 sec.
2026-07-15 21:30:14 00712_prewhere_with_alias: [ OK ] 3.36 sec.
2026-07-15 21:30:14 01322_cast_keep_nullable: [ OK ] 1.16 sec.
2026-07-15 21:30:15 00981_in_subquery_with_tuple: [ OK ] 10.12 sec.
2026-07-15 21:30:15 02291_dictionary_scalar_subquery_reload: [ OK ] 1.29 sec.
2026-07-15 21:30:15 02474_timeDiff_UTCTimestamp: [ OK ] 1.09 sec.
2026-07-15 21:30:16 01658_values_ubsan: [ OK ] 0.79 sec.
2026-07-15 21:30:17 02456_alter-nullable-column-bag: [ OK ] 1.61 sec.
2026-07-15 21:30:17 01049_zookeeper_synchronous_mutations_long: [ OK ] 3.26 sec.
2026-07-15 21:30:18 01921_datatype_date32: [ OK ] 6.09 sec.
2026-07-15 21:30:19 03206_no_exceptions_clickhouse_local: [ FAIL ] 2.56 sec.
2026-07-15 21:30:19 Reason: return code: 134, result:
2026-07-15 21:30:19
2026-07-15 21:30:19
2026-07-15 21:30:19
2026-07-15 21:30:19 stdout:
2026-07-15 21:30:19
2026-07-15 21:30:19
2026-07-15 21:30:19 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 8445523 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 13590787 --max_read_buffer_size 632125 --prefer_localhost_replica 0 --max_block_size 74866 --max_joined_block_size_rows 47678 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 70 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 25915921 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method pread --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 6 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 0 --max_bytes_before_external_group_by 0 --max_bytes_before_remerge_sort 1000854712 --min_compress_block_size 120549 --max_compress_block_size 815413 --merge_tree_compact_parts_min_granules_to_multibuffer_read 86 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 1364244 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone America/Campo_Grande --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.4 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 10 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1
2026-07-15 21:30:19
2026-07-15 21:30:19 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 9209594519 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 6850173481 --index_granularity_bytes 15891436 --merge_max_block_size 9768 --index_granularity 11590 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 20198 --primary_key_compress_block_size 64165 --replace_long_file_name_to_hash 1 --max_file_name_length 15 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 351772329 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 31685682 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 425
2026-07-15 21:30:19
2026-07-15 21:30:19 Database: test_pa94hu8v
2026-07-15 21:30:19 01021_only_tuple_columns: [ OK ] 1.60 sec.
2026-07-15 21:30:19 02125_constant_if_condition_and_not_existing_column: [ OK ] 1.10 sec.
2026-07-15 21:30:20 01585_fuzz_bits_with_bugfix: [ OK ] 0.84 sec.
2026-07-15 21:30:21 02971_functions_to_subcolumns_map: [ OK ] 1.09 sec.
2026-07-15 21:30:21 01136_multiple_sets: [ OK ] 1.64 sec.
2026-07-15 21:30:21 01461_query_start_time_microseconds: [ OK ] 4.67 sec.
2026-07-15 21:30:22 00471_sql_style_quoting: [ OK ] 0.81 sec.
2026-07-15 21:30:23 02354_vector_search_default_granularity: [ OK ] 1.05 sec.
2026-07-15 21:30:23 02316_const_string_intersact: [ OK ] 0.75 sec.
2026-07-15 21:30:24 01825_new_type_json_add_column: [ OK ] 2.05 sec.
2026-07-15 21:30:28 01825_type_json_4: [ OK ] 9.27 sec.
2026-07-15 21:30:29 01548_uncomparable_columns_in_keys: [ OK ] 1.02 sec.
2026-07-15 21:30:33 02968_full_sorting_join_fuzz: [ OK ] 17.99 sec.
2026-07-15 21:30:33 01077_mutations_index_consistency: [ OK ] 12.61 sec.
2026-07-15 21:30:35 01532_clickhouse_local_tmp_folder: [ OK ] 2.55 sec.
2026-07-15 21:30:35 01945_system_warnings: [ OK ] 6.34 sec.
2026-07-15 21:30:35 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:30:35 Reason: not running for current build
2026-07-15 21:30:36 01921_test_progress_bar: [ OK ] 0.74 sec.
2026-07-15 21:30:37 01656_sequence_next_node_long: [ OK ] 23.11 sec.
2026-07-15 21:30:37 00453_cast_enum: [ OK ] 1.00 sec.
2026-07-15 21:30:38 02661_read_from_archive_zip: [ OK ] 31.19 sec.
2026-07-15 21:30:38 02841_tuple_modulo: [ OK ] 0.79 sec.
2026-07-15 21:30:38 02699_polygons_sym_difference_total: [ OK ] 0.90 sec.
2026-07-15 21:30:38 02408_to_fixed_string_short_circuit: [ OK ] 0.79 sec.
2026-07-15 21:30:39 02326_numbers_from_json_strings_schema_inference: [ OK ] 1.00 sec.
2026-07-15 21:30:39 01527_bad_aggregation_in_lambda: [ OK ] 0.90 sec.
2026-07-15 21:30:39 00974_adaptive_granularity_secondary_index: [ OK ] 3.66 sec.
2026-07-15 21:30:39 02023_storage_filelog: [ OK ] 14.82 sec.
2026-07-15 21:30:40 01554_interpreter_integer_float: [ OK ] 1.18 sec.
2026-07-15 21:30:40 00566_enum_min_max: [ OK ] 1.15 sec.
2026-07-15 21:30:41 01605_skip_idx_compact_parts: [ OK ] 1.29 sec.
2026-07-15 21:30:41 01621_sort_after_join_pipeline_stuck: [ OK ] 1.22 sec.
2026-07-15 21:30:41 02416_rocksdb_delete_update: [ OK ] 1.85 sec.
2026-07-15 21:30:41 02366_window_function_order_by: [ OK ] 0.98 sec.
2026-07-15 21:30:42 01821_to_date_time_ubsan: [ OK ] 1.04 sec.
2026-07-15 21:30:44 00695_pretty_max_column_pad_width: [ OK ] 1.08 sec.
2026-07-15 21:30:45 02162_array_first_last_index: [ OK ] 3.15 sec.
2026-07-15 21:30:46 00960_eval_ml_method_const: [ OK ] 1.32 sec.
2026-07-15 21:30:46 02021_map_bloom_filter_index: [ OK ] 7.28 sec.
2026-07-15 21:30:46 03093_special_column_errors: [ OK ] 4.58 sec.
2026-07-15 21:30:49 01268_procfs_metrics: [ OK ] 4.35 sec.
2026-07-15 21:30:50 00686_client_exit_code: [ OK ] 3.12 sec.
2026-07-15 21:30:50 00064_negate_bug: [ OK ] 1.06 sec.
2026-07-15 21:30:52 01592_length_map: [ OK ] 1.81 sec.
2026-07-15 21:30:52 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 6.48 sec.
2026-07-15 21:30:52 01780_column_sparse_pk: [ OK ] 6.16 sec.
2026-07-15 21:30:53 00900_long_parquet: [ OK ] 81.48 sec.
2026-07-15 21:30:53 02985_if_over_big_int_decimal: [ OK ] 2.13 sec.
2026-07-15 21:30:53 01065_if_not_finite: [ OK ] 1.60 sec.
2026-07-15 21:30:54 02354_numeric_literals_with_underscores: [ OK ] 1.03 sec.
2026-07-15 21:30:58 02661_read_from_archive_tar: [ OK ] 34.17 sec.
2026-07-15 21:30:59 02358_file_default_value: [ OK ] 6.55 sec.
2026-07-15 21:31:00 01056_prepared_statements_null_and_escaping: [ OK ] 6.30 sec.
2026-07-15 21:31:02 01250_fixed_string_comparison: [ OK ] 2.12 sec.
2026-07-15 21:31:02 01398_in_tuple_func: [ OK ] 2.17 sec.
2026-07-15 21:31:02 02725_any_join_single_row: [ OK ] 8.73 sec.
2026-07-15 21:31:03 02004_max_hyperscan_regex_length: [ OK ] 10.96 sec.
2026-07-15 21:31:04 03161_ipv4_ipv6_equality: [ OK ] 1.43 sec.
2026-07-15 21:31:05 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 1.15 sec.
2026-07-15 21:31:06 01715_background_checker_blather_zookeeper_long: [ OK ] 13.10 sec.
2026-07-15 21:31:06 01293_external_sorting_limit_bug: [ OK ] 2.53 sec.
2026-07-15 21:31:06 02971_analyzer_remote_id: [ OK ] 3.97 sec.
2026-07-15 21:31:07 00059_shard_global_in_mergetree: [ OK ] 5.00 sec.
2026-07-15 21:31:07 03047_analyzer_alias_join: [ OK ] 1.04 sec.
2026-07-15 21:31:08 00499_json_enum_insert: [ OK ] 1.38 sec.
2026-07-15 21:31:08 03208_numbers_total_rows_approx: [ OK ] 0.94 sec.
2026-07-15 21:31:08 01923_different_expression_name_alias: [ OK ] 1.37 sec.
2026-07-15 21:31:09 00231_format_vertical_raw: [ OK ] 0.91 sec.
2026-07-15 21:31:10 01605_drop_settings_profile_while_assigned: [ OK ] 2.05 sec.
2026-07-15 21:31:14 03198_unload_primary_key_outdated: [ OK ] 9.02 sec.
2026-07-15 21:31:15 03230_subcolumns_mv: [ OK ] 6.65 sec.
2026-07-15 21:31:18 02457_parse_date_time_best_effort: [ OK ] 2.99 sec.
2026-07-15 21:31:18 02733_sparse_columns_reload: [ OK ] 7.25 sec.
2026-07-15 21:31:18 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec.
2026-07-15 21:31:18 Reason: not running for current build
2026-07-15 21:31:19 01550_create_map_type: [ OK ] 20.84 sec.
2026-07-15 21:31:19 03299_deep_nested_map_creation: [ OK ] 3.39 sec.
2026-07-15 21:31:19 00757_enum_defaults_const_analyzer: [ OK ] 1.20 sec.
2026-07-15 21:31:20 00938_test_retention_function: [ OK ] 2.02 sec.
2026-07-15 21:31:21 02375_pretty_formats: [ OK ] 1.94 sec.
2026-07-15 21:31:21 02994_merge_tree_mutations_cleanup: [ OK ] 14.75 sec.
2026-07-15 21:31:21 02207_ttl_move_if_exists: [ OK ] 1.07 sec.
2026-07-15 21:31:21 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 48.08 sec.
2026-07-15 21:31:22 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 1.24 sec.
2026-07-15 21:31:23 01942_snowflakeIDToDateTime: [ OK ] 2.44 sec.
2026-07-15 21:31:24 01067_join_null: [ OK ] 1.15 sec.
2026-07-15 21:31:25 02899_distributed_limit_by: [ OK ] 6.41 sec.
2026-07-15 21:31:26 02833_std_alias: [ OK ] 1.11 sec.
2026-07-15 21:31:26 00997_trim: [ OK ] 4.51 sec.
2026-07-15 21:31:27 03085_analyzer_alias_column_group_by: [ OK ] 1.00 sec.
2026-07-15 21:31:27 02718_parquet_metadata_format: [ OK ] 6.03 sec.
2026-07-15 21:31:28 01247_least_greatest_filimonov: [ OK ] 1.05 sec.
2026-07-15 21:31:28 02024_join_on_or_long: [ OK ] 19.23 sec.
2026-07-15 21:31:29 01080_window_view_inner_table_memory_hop: [ OK ] 9.68 sec.
2026-07-15 21:31:31 02476_analyzer_identifier_hints: [ OK ] 49.93 sec.
2026-07-15 21:31:31 02354_vector_search_bugs: [ OK ] 2.72 sec.
2026-07-15 21:31:33 02243_ipv6_long_parsing: [ OK ] 1.51 sec.
2026-07-15 21:31:34 03037_union_view: [ OK ] 1.36 sec.
2026-07-15 21:31:35 00754_alter_modify_column_partitions: [ OK ] 5.81 sec.
2026-07-15 21:31:35 00966_invalid_json_must_not_parse: [ OK ] 1.06 sec.
2026-07-15 21:31:36 00029_test_zookeeper_optimize_exception: [ OK ] 14.17 sec.
2026-07-15 21:31:37 01889_clickhouse_client_config_format: [ OK ] 6.62 sec.
2026-07-15 21:31:39 03003_count_asterisk_filter: [ OK ] 1.15 sec.
2026-07-15 21:31:39 01750_parsing_exception: [ OK ] 3.13 sec.
2026-07-15 21:31:40 00434_tonullable: [ OK ] 0.95 sec.
2026-07-15 21:31:40 01202_array_auc_special: [ OK ] 1.56 sec.
2026-07-15 21:31:40 00936_substring_utf8_non_const: [ OK ] 14.90 sec.
2026-07-15 21:31:41 00593_union_all_assert_columns_removed: [ OK ] 1.02 sec.
2026-07-15 21:31:41 02457_morton_coding: [ OK ] 4.38 sec.
2026-07-15 21:31:41 03200_subcolumns_join_use_nulls: [ OK ] 0.99 sec.
2026-07-15 21:31:42 02891_alter_update_adaptive_granularity: [ OK ] 1.15 sec.
2026-07-15 21:31:42 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 13.81 sec.
2026-07-15 21:31:42 01072_drop_temporary_table_with_same_name: [ OK ] 1.05 sec.
2026-07-15 21:31:42 02340_union_header: [ OK ] 0.95 sec.
2026-07-15 21:31:43 02461_welch_t_test_fuzz: [ OK ] 1.00 sec.
2026-07-15 21:31:43 02787_transform_null: [ OK ] 1.25 sec.
2026-07-15 21:31:43 00251_has_types: [ OK ] 1.61 sec.
2026-07-15 21:31:44 00819_ast_refactoring_bugs: [ OK ] 1.15 sec.
2026-07-15 21:31:44 01825_type_json_empty_string: [ OK ] 1.02 sec.
2026-07-15 21:31:44 02154_bitmap_contains: [ OK ] 0.95 sec.
2026-07-15 21:31:44 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 17.26 sec.
2026-07-15 21:31:45 02133_issue_32458: [ OK ] 1.11 sec.
2026-07-15 21:31:45 01633_limit_fuzz: [ OK ] 0.90 sec.
2026-07-15 21:31:46 02235_add_part_offset_virtual_column: [ OK ] 5.28 sec.
2026-07-15 21:31:47 00348_tuples: [ OK ] 1.71 sec.
2026-07-15 21:31:47 00389_concat_operator: [ OK ] 0.84 sec.
2026-07-15 21:31:47 03210_dynamic_squashing: [ OK ] 3.62 sec.
2026-07-15 21:31:49 01097_one_more_range_reader_test_wide_part: [ OK ] 1.45 sec.
2026-07-15 21:31:51 01343_min_bytes_to_use_mmap_io: [ OK ] 3.43 sec.
2026-07-15 21:31:52 00612_count: [ OK ] 2.59 sec.
2026-07-15 21:31:53 01831_max_streams: [ OK ] 0.85 sec.
2026-07-15 21:31:54 02833_local_with_dialect: [ OK ] 3.07 sec.
2026-07-15 21:31:55 02383_array_signed_const_positive_index: [ OK ] 1.92 sec.
2026-07-15 21:31:55 02869_unicode_minus: [ OK ] 0.85 sec.
2026-07-15 21:31:55 00667_compare_arrays_of_different_types: [ OK ] 0.89 sec.
2026-07-15 21:31:56 02201_use_skip_indexes_if_final: [ OK ] 1.34 sec.
2026-07-15 21:31:58 01074_h3_range_check: [ OK ] 1.15 sec.
2026-07-15 21:31:59 02956_clickhouse_local_system_parts: [ OK ] 3.88 sec.
2026-07-15 21:32:00 02488_zero_copy_detached_parts_drop_table: [ OK ] 12.77 sec.
2026-07-15 21:32:00 02319_dict_get_check_arguments_size: [ OK ] 2.10 sec.
2026-07-15 21:32:02 01701_clear_projection_and_part_remove: [ OK ] 1.80 sec.
2026-07-15 21:32:02 00700_decimal_null: [ OK ] 2.46 sec.
2026-07-15 21:32:02 03211_nested_json_merges: [ SKIPPED ] 0.00 sec.
2026-07-15 21:32:02 Reason: not running for current build
2026-07-15 21:32:03 02815_range_dict_no_direct_join: [ OK ] 1.15 sec.
2026-07-15 21:32:03 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 1.09 sec.
2026-07-15 21:32:03 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:32:03 Reason: not running for current build
2026-07-15 21:32:04 02366_kql_create_table: [ OK ] 1.29 sec.
2026-07-15 21:32:05 00160_merge_and_index_in_in: [ OK ] 20.87 sec.
2026-07-15 21:32:06 01411_xor_itai_shirav: [ OK ] 0.74 sec.
2026-07-15 21:32:06 03222_json_squashing: [ OK ] 6.17 sec.
2026-07-15 21:32:06 03036_dynamic_read_subcolumns_memory: [ SKIPPED ] 0.00 sec.
2026-07-15 21:32:06 Reason: not running for current build
2026-07-15 21:32:06 02097_remove_sample_by: [ OK ] 1.80 sec.
2026-07-15 21:32:07 01280_null_in: [ OK ] 0.95 sec.
2026-07-15 21:32:07 00500_point_in_polygon_non_const_poly: [ OK ] 4.01 sec.
2026-07-15 21:32:08 00351_select_distinct_arrays_tuples: [ OK ] 0.94 sec.
2026-07-15 21:32:10 02015_async_inserts_2: [ OK ] 3.91 sec.
2026-07-15 21:32:11 02420_stracktrace_debug_symbols: [ OK ] 3.05 sec.
2026-07-15 21:32:12 00732_decimal_summing_merge_tree: [ OK ] 1.40 sec.
2026-07-15 21:32:12 01604_explain_ast_of_nonselect_query: [ OK ] 0.85 sec.
2026-07-15 21:32:13 01891_not_like_partition_prune: [ OK ] 1.15 sec.
2026-07-15 21:32:14 01069_database_memory: [ OK ] 1.09 sec.
2026-07-15 21:32:18 01838_system_dictionaries_virtual_key_column: [ OK ] 3.10 sec.
2026-07-15 21:32:20 01901_in_literal_shard_prune: [ OK ] 2.34 sec.
2026-07-15 21:32:21 01710_projection_drop_if_exists: [ OK ] 1.28 sec.
2026-07-15 21:32:23 00607_index_in_in: [ OK ] 1.19 sec.
2026-07-15 21:32:23 02941_variant_type_2: [ OK ] 56.92 sec.
2026-07-15 21:32:23 00421_storage_merge__table_index: [ OK ] 39.68 sec.
2026-07-15 21:32:24 00955_complex_prepared_statements: [ OK ] 12.50 sec.
2026-07-15 21:32:25 01051_window_view_parser_hop: [ OK ] 1.94 sec.
2026-07-15 21:32:29 01273_arrow: [ OK ] 54.59 sec.
2026-07-15 21:32:30 02149_schema_inference: [ OK ] 44.50 sec.
2026-07-15 21:32:30 01509_check_many_parallel_quorum_inserts_long: [ OK ] 23.20 sec.
2026-07-15 21:32:31 00612_pk_in_tuple_perf: [ OK ] 8.12 sec.
2026-07-15 21:32:33 02962_indexHint_rpn_construction: [ OK ] 1.49 sec.
2026-07-15 21:32:33 00875_join_right_nulls: [ OK ] 3.51 sec.
2026-07-15 21:32:36 01076_json_each_row_array: [ OK ] 2.95 sec.
2026-07-15 21:32:38 00661_array_has_silviucpp: [ OK ] 1.24 sec.
2026-07-15 21:32:38 01518_select_in_null: [ OK ] 9.05 sec.
2026-07-15 21:32:39 01014_format_custom_separated: [ OK ] 9.11 sec.
2026-07-15 21:32:39 00968_roundAge: [ OK ] 1.00 sec.
2026-07-15 21:32:41 00514_interval_operators: [ OK ] 1.95 sec.
2026-07-15 21:32:42 02723_param_exception_message_context: [ OK ] 2.90 sec.
2026-07-15 21:32:43 01470_columns_transformers2: [ OK ] 1.40 sec.
2026-07-15 21:32:43 02174_cte_scalar_cache_mv: [ OK ] 20.29 sec.
2026-07-15 21:32:44 02875_final_invalid_read_ranges_bug: [ OK ] 1.61 sec.
2026-07-15 21:32:45 02868_select_support_from_keywords: [ OK ] 1.04 sec.
2026-07-15 21:32:46 02135_local_create_db: [ OK ] 2.91 sec.
2026-07-15 21:32:46 02842_mutations_replace_non_deterministic: [ OK ] 7.89 sec.
2026-07-15 21:32:46 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 3.17 sec.
2026-07-15 21:32:47 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 1.10 sec.
2026-07-15 21:32:47 01359_geodistance_loop: [ OK ] 0.76 sec.
2026-07-15 21:32:48 01165_lost_part_empty_partition: [ OK ] 14.42 sec.
2026-07-15 21:32:49 02800_transform_alter: [ OK ] 1.69 sec.
2026-07-15 21:32:49 00937_ipv4_cidr_range: [ OK ] 1.70 sec.
2026-07-15 21:32:50 02343_analyzer_column_transformers_strict: [ OK ] 1.24 sec.
2026-07-15 21:32:52 00679_replace_asterisk: [ OK ] 1.29 sec.
2026-07-15 21:32:52 01000_unneeded_substitutions_client: [ OK ] 2.95 sec.
2026-07-15 21:32:53 02875_show_functions: [ OK ] 4.96 sec.
2026-07-15 21:32:53 02912_group_array_sample: [ OK ] 1.12 sec.
2026-07-15 21:32:54 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.99 sec.
2026-07-15 21:32:59 00458_merge_type_cast: [ OK ] 5.57 sec.
2026-07-15 21:33:00 01781_token_extractor_buffer_overflow: [ OK ] 5.52 sec.
2026-07-15 21:33:00 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.78 sec.
2026-07-15 21:33:02 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 1.19 sec.
2026-07-15 21:33:03 03142_window_function_limit_by: [ OK ] 1.24 sec.
2026-07-15 21:33:04 00700_decimal_empty_aggregates: [ OK ] 5.23 sec.
2026-07-15 21:33:04 02581_share_big_sets_between_mutation_tasks: [ SKIPPED ] 0.00 sec.
2026-07-15 21:33:04 Reason: not running for current build
2026-07-15 21:33:06 00322_disable_checksumming: [ OK ] 2.83 sec.
2026-07-15 21:33:12 01446_json_strings_each_row: [ OK ] 25.70 sec.
2026-07-15 21:33:16 01710_projection_optimize_group_by_function_keys: [ OK ] 4.09 sec.
2026-07-15 21:33:19 02967_parallel_replicas_joins_and_analyzer: [ OK ] 26.54 sec.
2026-07-15 21:33:21 02150_index_hypothesis_race_long: [ OK ] 55.53 sec.
2026-07-15 21:33:25 02793_implicit_pretty_format_settings: [ OK ] 3.83 sec.
2026-07-15 21:33:25 02010_lc_native: [ OK ] 5.83 sec.
2026-07-15 21:33:26 00008_array_join: [ OK ] 0.84 sec.
2026-07-15 21:33:29 02493_max_streams_for_merge_tree_reading: [ OK ] 23.15 sec.
2026-07-15 21:33:30 02456_aggregate_state_conversion: [ OK ] 0.97 sec.
2026-07-15 21:33:31 03039_dynamic_collapsing_merge_tree: [ OK ] 45.46 sec.
2026-07-15 21:33:31 02457_csv_parse_date_out_of_range: [ OK ] 6.10 sec.
2026-07-15 21:33:32 02465_limit_trivial_max_rows_to_read: [ OK ] 1.15 sec.
2026-07-15 21:33:32 02428_parameterized_view: [ OK ] 85.72 sec.
2026-07-15 21:33:32 02734_sparse_columns_short_circuit: [ OK ] 1.20 sec.
2026-07-15 21:33:32 01273_arrow_load: [ OK ] 6.05 sec.
2026-07-15 21:33:33 03039_dynamic_aggregating_merge_tree: [ OK ] 68.61 sec.
2026-07-15 21:33:34 02027_ngrams: [ OK ] 2.55 sec.
2026-07-15 21:33:34 02835_join_step_explain: [ OK ] 1.10 sec.
2026-07-15 21:33:36 01376_array_fill_empty: [ OK ] 0.90 sec.
2026-07-15 21:33:42 01762_deltasumtimestamp: [ OK ] 6.74 sec.
2026-07-15 21:33:48 03148_asof_join_ddb_subquery: [ OK ] 4.40 sec.
2026-07-15 21:33:49 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 17.59 sec.
2026-07-15 21:33:58 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 9.42 sec.
2026-07-15 21:34:00 02265_per_table_ttl_mutation_on_change: [ OK ] 21.18 sec.
2026-07-15 21:34:05 02697_stop_reading_on_first_cancel: [ OK ] 4.79 sec.
2026-07-15 21:34:07 02383_schema_inference_hints: [ OK ] 7.37 sec.
2026-07-15 21:34:14 02041_openssl_hash_functions_test: [ OK ] 3.52 sec.
2026-07-15 21:34:14 00652_mutations_alter_update: [ OK ] 70.16 sec.
2026-07-15 21:34:19 02896_cyclic_aliases_crash: [ OK ] 13.23 sec.
2026-07-15 21:34:19 01691_DateTime64_clamp: [ OK ] 4.51 sec.
2026-07-15 21:34:23 02935_http_content_type_with_http_headers_progress: [ OK ] 50.27 sec.
2026-07-15 21:34:23 02071_lower_upper_utf8_row_overlaps: [ OK ] 3.61 sec.
2026-07-15 21:34:23 01019_materialized_view_select_extra_columns: [ OK ] 3.97 sec.
2026-07-15 21:34:24 02315_pmj_union_ubsan_35857: [ OK ] 0.90 sec.
2026-07-15 21:34:24 01319_query_formatting_in_server_log: [ OK ] 34.27 sec.
2026-07-15 21:34:25 03167_fancy_quotes_off_by_one: [ OK ] 0.98 sec.
2026-07-15 21:34:25 01948_group_bitmap_and_or_xor_fix: [ OK ] 1.37 sec.
2026-07-15 21:34:26 02835_fuzz_remove_redundant_sorting: [ OK ] 2.36 sec.
2026-07-15 21:34:28 00825_protobuf_format_splitted_nested: [ OK ] 12.81 sec.
2026-07-15 21:34:28 00003_reinterpret_as_string: [ OK ] 0.79 sec.
2026-07-15 21:34:29 01798_uniq_theta_sketch: [ OK ] 6.09 sec.
2026-07-15 21:34:30 02894_ast_depth_check: [ OK ] 3.14 sec.
2026-07-15 21:34:31 00880_decimal_in_key: [ OK ] 2.82 sec.
2026-07-15 21:34:32 01825_new_type_json_7: [ OK ] 6.94 sec.
2026-07-15 21:34:32 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 1.04 sec.
2026-07-15 21:34:33 03221_merge_profile_events: [ OK ] 60.53 sec.
2026-07-15 21:34:33 01283_max_threads_simple_query_optimization: [ OK ] 8.04 sec.
2026-07-15 21:34:33 00803_odbc_driver_2_format: [ OK ] 0.79 sec.
2026-07-15 21:34:34 03273_dynamic_pretty_json_serialization: [ OK ] 0.84 sec.
2026-07-15 21:34:34 03165_storage_merge_view_prewhere: [ OK ] 1.29 sec.
2026-07-15 21:34:35 01509_format_raw_blob: [ OK ] 5.17 sec.
2026-07-15 21:34:35 02482_execute_functions_before_sorting_bug: [ OK ] 1.25 sec.
2026-07-15 21:34:36 02013_json_function_null_column: [ OK ] 1.95 sec.
2026-07-15 21:34:36 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 2.89 sec.
2026-07-15 21:34:37 00460_vertical_and_totals_extremes: [ OK ] 1.04 sec.
2026-07-15 21:34:38 01392_column_resolve: [ OK ] 1.20 sec.
2026-07-15 21:34:41 00601_kill_running_query: [ OK ] 2.55 sec.
2026-07-15 21:34:41 03031_clickhouse_local_input: [ OK ] 4.48 sec.
2026-07-15 21:34:43 02751_text_formats_bad_nullable_parsing: [ OK ] 7.98 sec.
2026-07-15 21:34:45 02212_h3_get_pentagon_indexes: [ OK ] 1.60 sec.
2026-07-15 21:34:46 00102_insert_into_temporary_table: [ OK ] 0.79 sec.
2026-07-15 21:34:49 02380_insert_mv_race: [ OK ] 8.36 sec.
2026-07-15 21:34:51 00950_default_prewhere: [ OK ] 1.45 sec.
2026-07-15 21:34:52 02372_analyzer_join: [ OK ] 23.09 sec.
2026-07-15 21:34:53 01770_extended_range_3: [ OK ] 0.84 sec.
2026-07-15 21:34:54 02562_native_tskv_default_for_omitted_fields: [ OK ] 13.16 sec.
2026-07-15 21:34:55 00821_distributed_storage_with_join_on: [ OK ] 1.24 sec.
2026-07-15 21:34:55 02513_broken_datetime64_init_on_mac: [ OK ] 0.74 sec.
2026-07-15 21:34:56 01358_constexpr_constraint: [ OK ] 1.04 sec.
2026-07-15 21:34:57 00603_system_parts_nonexistent_database: [ OK ] 0.80 sec.
2026-07-15 21:35:00 01661_week_functions_string_args: [ OK ] 2.50 sec.
2026-07-15 21:35:00 02122_join_group_by_timeout: [ OK ] 14.01 sec.
2026-07-15 21:35:00 02122_parallel_formatting_JSON: [ OK ] 9.24 sec.
2026-07-15 21:35:01 01576_if_null_external_aggregation: [ OK ] 7.08 sec.
2026-07-15 21:35:01 03325_distributed_join_json_array_subcolumns: [ OK ] 1.24 sec.
2026-07-15 21:35:02 00441_nulls_in: [ OK ] 1.80 sec.
2026-07-15 21:35:02 02515_tuple_lambda_parsing: [ OK ] 0.64 sec.
2026-07-15 21:35:03 00732_base64_functions: [ OK ] 1.46 sec.
2026-07-15 21:35:03 00712_prewhere_with_final: [ OK ] 1.11 sec.
2026-07-15 21:35:03 00834_limit_with_constant_expressions: [ OK ] 1.49 sec.
2026-07-15 21:35:04 01176_mysql_client_interactive: [ OK ] 3.51 sec.
2026-07-15 21:35:04 02500_remove_redundant_distinct_analyzer: [ OK ] 32.15 sec.
2026-07-15 21:35:04 01558_transform_null_in: [ OK ] 1.50 sec.
2026-07-15 21:35:05 00178_query_datetime64_index: [ OK ] 0.99 sec.
2026-07-15 21:35:05 00943_mv_rename_without_inner_table: [ OK ] 1.15 sec.
2026-07-15 21:35:05 01063_create_column_set: [ OK ] 0.94 sec.
2026-07-15 21:35:06 01118_is_constant: [ OK ] 1.04 sec.
2026-07-15 21:35:06 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.95 sec.
2026-07-15 21:35:06 01650_expressions_merge_bug: [ OK ] 0.84 sec.
2026-07-15 21:35:06 01505_pipeline_executor_UAF: [ OK ] 31.51 sec.
2026-07-15 21:35:06 01182_materialized_view_different_structure: [ OK ] 2.38 sec.
2026-07-15 21:35:06 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.84 sec.
2026-07-15 21:35:07 01041_h3_is_valid: [ OK ] 0.89 sec.
2026-07-15 21:35:07 01051_same_name_alias_with_joins: [ OK ] 1.20 sec.
2026-07-15 21:35:08 02932_parallel_replicas_fuzzer: [ OK ] 1.50 sec.
2026-07-15 21:35:09 02250_ON_CLUSTER_grant: [ OK ] 5.67 sec.
2026-07-15 21:35:09 02840_grace_hash_join_structure_mismatch: [ OK ] 0.89 sec.
2026-07-15 21:35:09 03093_reading_bug_with_parallel_replicas: [ OK ] 2.25 sec.
2026-07-15 21:35:11 01944_insert_partition_by: [ OK ] 1.90 sec.
2026-07-15 21:35:12 02154_bit_slice_for_fixedstring: [ OK ] 5.75 sec.
2026-07-15 21:35:13 02500_bson_read_object_id: [ OK ] 3.43 sec.
2026-07-15 21:35:14 01043_dictionary_attribute_properties_values: [ OK ] 1.16 sec.
2026-07-15 21:35:15 01601_proxy_protocol: [ OK ] 2.38 sec.
2026-07-15 21:35:20 01058_window_view_event_hop_to_strict_asc: [ OK ] 8.67 sec.
2026-07-15 21:35:21 00903_array_with_constant_function: [ OK ] 0.91 sec.
2026-07-15 21:35:24 02111_with_fill_no_rows: [ OK ] 1.41 sec.
2026-07-15 21:35:24 01720_country_perimeter_and_area: [ OK ] 16.99 sec.
2026-07-15 21:35:25 02340_analyzer_functions: [ OK ] 1.41 sec.
2026-07-15 21:35:26 00940_order_by_read_in_order_query_plan: [ OK ] 10.37 sec.
2026-07-15 21:35:28 02367_analyzer_table_alias_columns: [ OK ] 1.86 sec.
2026-07-15 21:35:28 01935_parametrized_query_parametric_aggregate_function: [ OK ] 2.48 sec.
2026-07-15 21:35:29 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 1.33 sec.
2026-07-15 21:35:30 00394_new_nested_column_keeps_offsets: [ OK ] 1.75 sec.
2026-07-15 21:35:30 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec.
2026-07-15 21:35:30 Reason: not running for current build
2026-07-15 21:35:31 02684_bson: [ OK ] 0.96 sec.
2026-07-15 21:35:32 03161_lightweight_delete_projection: [ OK ] 2.43 sec.
2026-07-15 21:35:33 02935_ipv6_bit_operations: [ OK ] 1.11 sec.
2026-07-15 21:35:34 03013_position_const_start_pos: [ OK ] 1.07 sec.
2026-07-15 21:35:36 00848_join_use_nulls_segfault: [ OK ] 5.17 sec.
2026-07-15 21:35:37 00932_array_intersect_bug: [ OK ] 1.23 sec.
2026-07-15 21:35:37 01012_serialize_array_memory_usage: [ OK ] 3.07 sec.
2026-07-15 21:35:38 02981_translate_fixedstring: [ OK ] 0.86 sec.
2026-07-15 21:35:39 02902_add_scalar_in_all_case: [ OK ] 1.54 sec.
2026-07-15 21:35:40 00340_squashing_insert_select: [ OK ] 16.28 sec.
2026-07-15 21:35:41 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 1.96 sec.
2026-07-15 21:35:42 01040_h3_get_resolution: [ OK ] 1.11 sec.
2026-07-15 21:35:43 00361_shared_array_offsets_and_squash_blocks: [ OK ] 1.62 sec.
2026-07-15 21:35:44 02011_normalize_utf8: [ OK ] 2.54 sec.
2026-07-15 21:35:45 02962_join_using_bug_57894: [ OK ] 1.81 sec.
2026-07-15 21:35:45 02514_tsv_zero_started_number: [ OK ] 0.91 sec.
2026-07-15 21:35:46 01093_cyclic_defaults_filimonov: [ OK ] 0.95 sec.
2026-07-15 21:35:46 02240_get_type_serialization_streams: [ OK ] 1.11 sec.
2026-07-15 21:35:48 00059_shard_global_in: [ OK ] 1.10 sec.
2026-07-15 21:35:48 01939_network_receive_bytes_metrics: [ OK ] 9.15 sec.
2026-07-15 21:35:53 02337_join_analyze_stuck: [ OK ] 5.65 sec.
2026-07-15 21:35:53 02226_low_cardinality_text_bloom_filter_index: [ OK ] 5.76 sec.
2026-07-15 21:35:55 01045_array_zip: [ OK ] 1.41 sec.
2026-07-15 21:35:59 00940_order_by_read_in_order: [ OK ] 4.46 sec.
2026-07-15 21:36:01 02903_bug_43644: [ OK ] 1.09 sec.
2026-07-15 21:36:02 01556_explain_select_with_union_query: [ OK ] 1.55 sec.
2026-07-15 21:36:03 01655_sleep_infinite_float: [ OK ] 0.87 sec.
2026-07-15 21:36:04 03151_external_cross_join: [ OK ] 17.68 sec.
2026-07-15 21:36:04 01710_minmax_count_projection_constant_query: [ OK ] 1.00 sec.
2026-07-15 21:36:05 02481_low_cardinality_with_short_circuit_functins: [ OK ] 1.71 sec.
2026-07-15 21:36:05 02191_parse_date_time_best_effort_more_cases: [ OK ] 1.12 sec.
2026-07-15 21:36:07 01702_system_numbers_scientific_notation: [ OK ] 1.10 sec.
2026-07-15 21:36:09 03208_buffer_over_distributed_type_mismatch: [ OK ] 3.37 sec.
2026-07-15 21:36:10 00149_function_url_hash: [ OK ] 1.30 sec.
2026-07-15 21:36:11 02444_async_broken_outdated_part_loading: [ OK ] 17.22 sec.
2026-07-15 21:36:11 01817_storage_buffer_parameters: [ OK ] 1.11 sec.
2026-07-15 21:36:14 00835_if_generic_case: [ OK ] 2.07 sec.
2026-07-15 21:36:14 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec.
2026-07-15 21:36:14 Reason: not running for current build
2026-07-15 21:36:14 00284_external_aggregation_2: [ OK ] 60.08 sec.
2026-07-15 21:36:16 02477_analyzer_array_join_with_join: [ OK ] 4.83 sec.
2026-07-15 21:36:17 01412_group_array_moving_shard: [ OK ] 3.08 sec.
2026-07-15 21:36:18 02515_and_or_if_multiif_not_return_lc: [ OK ] 1.10 sec.
2026-07-15 21:36:19 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 5.13 sec.
2026-07-15 21:36:20 02688_aggregate_states: [ OK ] 1.65 sec.
2026-07-15 21:36:21 01548_with_totals_having: [ OK ] 1.22 sec.
2026-07-15 21:36:22 01246_extractAllGroupsVertical: [ OK ] 2.80 sec.
2026-07-15 21:36:24 00004_shard_format_ast_and_remote_table: [ OK ] 1.62 sec.
2026-07-15 21:36:24 02124_insert_deduplication_token: [ OK ] 3.34 sec.
2026-07-15 21:36:24 01961_roaring_memory_tracking: [ SKIPPED ] 0.00 sec.
2026-07-15 21:36:24 Reason: not running for current build
2026-07-15 21:36:25 02017_columns_with_dot: [ OK ] 1.60 sec.
2026-07-15 21:36:26 02553_type_object_analyzer: [ OK ] 1.12 sec.
2026-07-15 21:36:27 01277_fromUnixTimestamp64: [ OK ] 1.67 sec.
2026-07-15 21:36:28 02047_log_family_complex_structs_data_file_dumps: [ OK ] 20.90 sec.
2026-07-15 21:36:29 03036_schema_inference_cache_s3_archives: [ OK ] 1.52 sec.
2026-07-15 21:36:30 01825_new_type_json_11: [ OK ] 14.84 sec.
2026-07-15 21:36:31 03041_analyzer_gigachad_join: [ OK ] 1.35 sec.
2026-07-15 21:36:31 02577_analyzer_array_join_calc_twice: [ OK ] 0.89 sec.
2026-07-15 21:36:31 03015_optimize_final_rmt: [ SKIPPED ] 0.00 sec.
2026-07-15 21:36:31 Reason: not running for current build
2026-07-15 21:36:32 01284_view_and_extremes_bug: [ OK ] 1.12 sec.
2026-07-15 21:36:32 02499_escaped_quote_schema_inference: [ OK ] 0.82 sec.
2026-07-15 21:36:34 01710_force_use_projection: [ OK ] 1.85 sec.
2026-07-15 21:36:35 01395_limit_more_cases: [ OK ] 198.79 sec.
2026-07-15 21:36:36 00826_cross_to_inner_join: [ OK ] 4.14 sec.
2026-07-15 21:36:37 00328_long_case_construction: [ OK ] 185.00 sec.
2026-07-15 21:36:37 01507_transform_null_in: [ OK ] 1.15 sec.
2026-07-15 21:36:37 02022_storage_filelog_one_file: [ OK ] 11.28 sec.
2026-07-15 21:36:38 01600_multiple_left_join_with_aliases: [ OK ] 1.05 sec.
2026-07-15 21:36:39 00910_crash_when_distributed_modify_order_by: [ OK ] 1.10 sec.
2026-07-15 21:36:40 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 1.11 sec.
2026-07-15 21:36:40 02205_map_populate_series_non_const: [ OK ] 3.67 sec.
2026-07-15 21:36:41 01091_insert_with_default_json: [ OK ] 1.10 sec.
2026-07-15 21:36:42 01716_drop_rename_sign_column: [ OK ] 1.05 sec.
2026-07-15 21:36:44 00909_kill_not_initialized_query: [ OK ] 16.13 sec.
2026-07-15 21:36:44 00384_column_aggregate_function_insert_from: [ OK ] 1.82 sec.
2026-07-15 21:36:45 01825_type_json_15: [ OK ] 8.12 sec.
2026-07-15 21:36:45 00097_long_storage_buffer_race_condition: [ OK ] 98.58 sec.
2026-07-15 21:36:46 01845_add_testcase_for_arrayElement: [ OK ] 1.21 sec.
2026-07-15 21:36:46 01521_max_length_alias: [ OK ] 1.96 sec.
2026-07-15 21:36:47 02221_system_zookeeper_unrestricted_like: [ OK ] 10.60 sec.
2026-07-15 21:36:47 02906_flatten_only_true_nested: [ OK ] 1.05 sec.
2026-07-15 21:36:47 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 2.12 sec.
2026-07-15 21:36:48 02131_row_policies_combination: [ OK ] 2.27 sec.
2026-07-15 21:36:48 02992_analyzer_group_by_const: [ OK ] 2.72 sec.
2026-07-15 21:36:49 00794_materialized_view_with_column_defaults: [ OK ] 1.25 sec.
2026-07-15 21:36:50 03018_external_with_complex_data_types: [ OK ] 3.18 sec.
2026-07-15 21:36:51 03003_database_filesystem_format_detection: [ OK ] 3.56 sec.
2026-07-15 21:36:51 02482_value_block_parsing: [ OK ] 3.37 sec.
2026-07-15 21:36:52 02458_key_condition_not_like_prefix: [ OK ] 1.56 sec.
2026-07-15 21:36:52 01445_create_table_as_table_function: [ OK ] 4.83 sec.
2026-07-15 21:36:53 02354_parse_timedelta: [ OK ] 2.21 sec.
2026-07-15 21:36:53 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 1.86 sec.
2026-07-15 21:36:54 01441_array_combinator: [ OK ] 0.79 sec.
2026-07-15 21:36:54 01477_lc_in_merge_join_left_key: [ OK ] 4.59 sec.
2026-07-15 21:36:54 00262_alter_alias: [ OK ] 1.61 sec.
2026-07-15 21:36:55 00185_array_literals: [ OK ] 1.40 sec.
2026-07-15 21:36:55 02481_async_insert_dedup_token: [ OK ] 106.17 sec.
2026-07-15 21:36:55 02041_test_fuzzy_alter: [ OK ] 1.45 sec.
2026-07-15 21:36:56 00449_filter_array_nullable_tuple: [ OK ] 1.20 sec.
2026-07-15 21:36:56 00552_logical_functions_simple: [ OK ] 1.15 sec.
2026-07-15 21:36:57 01025_array_compact_generic: [ OK ] 1.26 sec.
2026-07-15 21:36:58 00240_replace_substring_loop: [ OK ] 6.62 sec.
2026-07-15 21:36:58 03204_distributed_with_scalar_subquery: [ OK ] 1.22 sec.
2026-07-15 21:36:59 00229_prewhere_column_missing: [ OK ] 2.23 sec.
2026-07-15 21:36:59 00627_recursive_alias: [ OK ] 0.96 sec.
2026-07-15 21:37:00 01655_window_functions_bug: [ OK ] 1.01 sec.
2026-07-15 21:37:00 01440_big_int_shift: [ OK ] 0.99 sec.
2026-07-15 21:37:01 01710_normal_projections: [ OK ] 20.08 sec.
2026-07-15 21:37:01 01825_type_json_5: [ OK ] 1.31 sec.
2026-07-15 21:37:02 00277_array_filter: [ OK ] 0.95 sec.
2026-07-15 21:37:03 00568_empty_function_with_fixed_string: [ OK ] 1.06 sec.
2026-07-15 21:37:03 01280_min_map_max_map: [ OK ] 2.72 sec.
2026-07-15 21:37:03 02860_distributed_flush_on_detach: [ OK ] 1.46 sec.
2026-07-15 21:37:03 01550_query_identifier_parameters: [ OK ] 6.66 sec.
2026-07-15 21:37:03 02430_initialize_aggregation_with_combinators: [ OK ] 0.84 sec.
2026-07-15 21:37:04 02383_arrow_dict_special_cases: [ OK ] 10.38 sec.
2026-07-15 21:37:04 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 1.50 sec.
2026-07-15 21:37:04 00967_insert_into_distributed_different_types: [ OK ] 1.19 sec.
2026-07-15 21:37:06 01470_test_insert_select_asterisk: [ OK ] 1.40 sec.
2026-07-15 21:37:07 02095_function_get_os_kernel_version: [ OK ] 0.75 sec.
2026-07-15 21:37:08 02935_format_with_arbitrary_types: [ OK ] 3.50 sec.
2026-07-15 21:37:08 02377_analyzer_in_function_set: [ OK ] 1.00 sec.
2026-07-15 21:37:08 02266_protobuf_format_google_wrappers: [ OK ] 14.12 sec.
2026-07-15 21:37:09 00725_join_on_bug_3: [ OK ] 1.35 sec.
2026-07-15 21:37:10 02454_set_parameters_formatting: [ OK ] 2.65 sec.
2026-07-15 21:37:11 00700_to_decimal_or_something: [ OK ] 2.96 sec.
2026-07-15 21:37:11 00980_full_join_crash_fancyqlx: [ OK ] 1.33 sec.
2026-07-15 21:37:11 02950_parallel_replicas_used_count: [ OK ] 7.83 sec.
2026-07-15 21:37:12 03023_remove_unused_column_distinct: [ OK ] 0.95 sec.
2026-07-15 21:37:12 02575_merge_prewhere_default_expression: [ OK ] 1.25 sec.
2026-07-15 21:37:13 02045_like_function: [ OK ] 0.91 sec.
2026-07-15 21:37:13 02974_if_with_map: [ OK ] 1.81 sec.
2026-07-15 21:37:14 03243_create_or_replace_view_dependency_check: [ OK ] 1.39 sec.
2026-07-15 21:37:17 02119_sumcount: [ OK ] 3.70 sec.
2026-07-15 21:37:17 01444_create_table_drop_database_race: [ OK ] 13.18 sec.
2026-07-15 21:37:17 02176_dict_get_has_implicit_key_cast: [ OK ] 3.47 sec.
2026-07-15 21:37:18 00952_basic_constraints: [ OK ] 14.68 sec.
2026-07-15 21:37:18 00066_group_by_in: [ OK ] 0.97 sec.
2026-07-15 21:37:20 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 1.47 sec.
2026-07-15 21:37:20 00957_neighbor: [ OK ] 2.83 sec.
2026-07-15 21:37:21 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 2.33 sec.
2026-07-15 21:37:21 01278_variance_nonnegative: [ OK ] 1.64 sec.
2026-07-15 21:37:21 03013_ignore_drop_queries_probability: [ OK ] 1.36 sec.
2026-07-15 21:37:22 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 4.31 sec.
2026-07-15 21:37:22 03246_alter_update_dynamic_hung: [ OK ] 1.40 sec.
2026-07-15 21:37:22 01660_second_extremes_bug: [ OK ] 1.01 sec.
2026-07-15 21:37:23 02007_join_use_nulls: [ OK ] 1.35 sec.
2026-07-15 21:37:24 00929_multi_match_edit_distance: [ OK ] 10.84 sec.
2026-07-15 21:37:24 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:37:24 Reason: not running for current build
2026-07-15 21:37:25 02566_analyzer_limit_settings_distributed: [ OK ] 2.02 sec.
2026-07-15 21:37:26 00172_constexprs_in_set: [ OK ] 2.30 sec.
2026-07-15 21:37:30 01281_sum_nullable: [ OK ] 4.93 sec.
2026-07-15 21:37:30 02177_issue_31009: [ SKIPPED ] 0.00 sec.
2026-07-15 21:37:30 Reason: not running for current build
2026-07-15 21:37:30 02315_readonly_create_function: [ OK ] 3.49 sec.
2026-07-15 21:37:32 02921_bit_hamming_distance_big_int: [ OK ] 1.73 sec.
2026-07-15 21:37:32 02875_merge_engine_set_index: [ OK ] 8.72 sec.
2026-07-15 21:37:32 02271_replace_partition_many_tables: [ OK ] 33.44 sec.
2026-07-15 21:37:33 01893_jit_aggregation_function_min_long: [ OK ] 10.60 sec.
2026-07-15 21:37:33 01818_move_partition_simple: [ OK ] 3.38 sec.
2026-07-15 21:37:33 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec.
2026-07-15 21:37:33 Reason: not running for current build
2026-07-15 21:37:33 01116_cross_count_asterisks: [ OK ] 1.39 sec.
2026-07-15 21:37:34 02245_s3_virtual_columns: [ OK ] 2.27 sec.
2026-07-15 21:37:35 02125_lz4_compression_bug_CSV: [ OK ] 24.05 sec.
2026-07-15 21:37:36 02981_variant_type_function: [ OK ] 1.53 sec.
2026-07-15 21:37:38 02031_format_query_option: [ OK ] 2.85 sec.
2026-07-15 21:37:39 02158_proportions_ztest_cmp: [ OK ] 6.42 sec.
2026-07-15 21:37:40 02702_allow_skip_errors_enum: [ OK ] 6.15 sec.
2026-07-15 21:37:40 03009_format_show_database: [ OK ] 4.01 sec.
2026-07-15 21:37:40 02146_mv_non_phys: [ OK ] 1.06 sec.
2026-07-15 21:37:42 03068_analyzer_distributed_join: [ OK ] 2.07 sec.
2026-07-15 21:37:42 02843_context_has_expired: [ OK ] 2.54 sec.
2026-07-15 21:37:52 03039_recursive_cte_postgres_5: [ OK ] 9.78 sec.
2026-07-15 21:37:53 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 15.36 sec.
2026-07-15 21:37:54 02751_query_log_test_partitions: [ OK ] 10.94 sec.
2026-07-15 21:37:54 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec.
2026-07-15 21:37:54 Reason: not running for current build
2026-07-15 21:37:55 02002_row_level_filter_bug: [ OK ] 21.54 sec.
2026-07-15 21:37:58 00969_roundDuration: [ OK ] 2.48 sec.
2026-07-15 21:37:59 02376_analyzer_in_function_subquery: [ OK ] 6.14 sec.
2026-07-15 21:37:59 03217_primary_index_memory_leak: [ SKIPPED ] 0.00 sec.
2026-07-15 21:37:59 Reason: not running for current build
2026-07-15 21:38:00 01651_lc_insert_tiny_log_1: [ OK ] 38.22 sec.
2026-07-15 21:38:00 02521_analyzer_array_join_crash: [ OK ] 1.62 sec.
2026-07-15 21:38:01 02813_func_now_and_alias: [ OK ] 1.21 sec.
2026-07-15 21:38:01 01430_fix_any_rewrite_aliases: [ OK ] 1.12 sec.
2026-07-15 21:38:03 01666_lcm_ubsan: [ OK ] 1.75 sec.
2026-07-15 21:38:04 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 1.00 sec.
2026-07-15 21:38:04 02766_prql: [ OK ] 5.47 sec.
2026-07-15 21:38:06 01780_column_sparse_full: [ OK ] 12.17 sec.
2026-07-15 21:38:06 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 2.19 sec.
2026-07-15 21:38:08 02890_partition_prune_in_extra_columns: [ OK ] 1.62 sec.
2026-07-15 21:38:12 02588_avro_date32_and_decimals: [ OK ] 5.87 sec.
2026-07-15 21:38:13 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 5.16 sec.
2026-07-15 21:38:14 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 12.53 sec.
2026-07-15 21:38:14 02112_skip_index_set_and_or: [ OK ] 1.32 sec.
2026-07-15 21:38:14 00950_bad_alloc_when_truncate_join_storage: [ OK ] 1.04 sec.
2026-07-15 21:38:15 03014_window_view_crash: [ OK ] 1.20 sec.
2026-07-15 21:38:16 02962_analyzer_constant_set: [ OK ] 1.49 sec.
2026-07-15 21:38:17 01017_bithamming_distance: [ OK ] 2.81 sec.
2026-07-15 21:38:17 01096_block_serialized_state: [ OK ] 1.26 sec.
2026-07-15 21:38:19 02128_cast_nullable: [ OK ] 2.10 sec.
2026-07-15 21:38:21 02731_nothing_deserialization: [ OK ] 1.31 sec.
2026-07-15 21:38:23 02522_different_types_in_storage_merge: [ OK ] 1.70 sec.
2026-07-15 21:38:24 01064_pm_all_join_const_and_nullable: [ OK ] 9.08 sec.
2026-07-15 21:38:26 02313_test_fpc_codec: [ OK ] 3.09 sec.
2026-07-15 21:38:29 02179_degrees_radians: [ OK ] 2.63 sec.
2026-07-15 21:38:31 02577_keepermap_delete_update: [ OK ] 2.27 sec.
2026-07-15 21:38:32 01825_type_json_7: [ OK ] 7.36 sec.
2026-07-15 21:38:32 03034_normalized_ast: [ OK ] 1.07 sec.
2026-07-15 21:38:33 02242_throw_if_constant_argument: [ OK ] 0.89 sec.
2026-07-15 21:38:33 01010_partial_merge_join: [ OK ] 15.72 sec.
2026-07-15 21:38:34 01312_case_insensitive_regexp: [ OK ] 1.30 sec.
2026-07-15 21:38:35 00678_shard_funnel_window: [ OK ] 3.29 sec.
2026-07-15 21:38:36 02918_template_format_deadlock: [ OK ] 2.93 sec.
2026-07-15 21:38:36 02364_window_case: [ OK ] 0.87 sec.
2026-07-15 21:38:36 02178_column_function_insert_from: [ OK ] 1.81 sec.
2026-07-15 21:38:37 03164_adapting_parquet_reader_output_size: [ OK ] 56.55 sec.
2026-07-15 21:38:38 02366_kql_distinct: [ OK ] 1.39 sec.
2026-07-15 21:38:38 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 1.96 sec.
2026-07-15 21:38:39 00395_nullable: [ OK ] 45.05 sec.
2026-07-15 21:38:39 02000_table_function_cluster_macros: [ OK ] 1.10 sec.
2026-07-15 21:38:40 01284_port: [ OK ] 3.27 sec.
2026-07-15 21:38:40 01906_partition_by_multiply_by_zero: [ OK ] 1.19 sec.
2026-07-15 21:38:40 00580_cast_nullable_to_non_nullable: [ OK ] 0.79 sec.
2026-07-15 21:38:41 00422_hash_function_constexpr: [ OK ] 0.85 sec.
2026-07-15 21:38:42 02946_literal_alias_misclassification: [ OK ] 1.20 sec.
2026-07-15 21:38:42 02383_join_and_filtering_set: [ SKIPPED ] 0.00 sec.
2026-07-15 21:38:42 Reason: not running for current build
2026-07-15 21:38:42 02319_sql_standard_create_drop_index: [ OK ] 2.51 sec.
2026-07-15 21:38:43 02456_keeper_retries_during_insert: [ OK ] 3.26 sec.
2026-07-15 21:38:44 01926_date_date_time_supertype: [ OK ] 1.14 sec.
2026-07-15 21:38:45 00831_quantile_weighted_parameter_check: [ OK ] 0.84 sec.
2026-07-15 21:38:46 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 1.10 sec.
2026-07-15 21:38:47 00063_check_query: [ OK ] 1.45 sec.
2026-07-15 21:38:48 00953_indices_alter_exceptions: [ OK ] 5.69 sec.
2026-07-15 21:38:48 01946_profile_sleep: [ OK ] 12.21 sec.
2026-07-15 21:38:48 03032_scalars_create_as_select: [ OK ] 1.10 sec.
2026-07-15 21:38:49 02479_analyzer_aggregation_crash: [ OK ] 1.33 sec.
2026-07-15 21:38:49 02267_insert_empty_data: [ OK ] 0.80 sec.
2026-07-15 21:38:52 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 2.42 sec.
2026-07-15 21:38:52 02516_projections_with_rollup: [ OK ] 12.34 sec.
2026-07-15 21:38:54 00673_subquery_prepared_set_performance: [ OK ] 2.47 sec.
2026-07-15 21:38:55 00898_parsing_bad_diagnostic_message: [ OK ] 3.08 sec.
2026-07-15 21:38:56 02361_fsync_profile_events: [ OK ] 7.12 sec.
2026-07-15 21:38:59 00650_csv_with_specified_quote_rule: [ OK ] 16.18 sec.
2026-07-15 21:39:01 00849_multiple_comma_join_2: [ OK ] 5.92 sec.
2026-07-15 21:39:01 02678_explain_pipeline_graph_with_projection: [ OK ] 2.11 sec.
2026-07-15 21:39:02 00473_output_format_json_quote_denormals: [ OK ] 7.97 sec.
2026-07-15 21:39:03 02158_ztest_cmp: [ OK ] 6.45 sec.
2026-07-15 21:39:04 03035_dynamic_sorting: [ OK ] 2.54 sec.
2026-07-15 21:39:04 00905_compile_expressions_compare_big_dates: [ OK ] 1.34 sec.
2026-07-15 21:39:05 00258_materializing_tuples: [ OK ] 1.24 sec.
2026-07-15 21:39:06 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.97 sec.
2026-07-15 21:39:06 02833_url_without_path_encoding: [ OK ] 4.72 sec.
2026-07-15 21:39:07 00152_totals_in_subquery: [ OK ] 1.13 sec.
2026-07-15 21:39:07 02428_index_analysis_with_null_literal: [ OK ] 4.79 sec.
2026-07-15 21:39:08 02012_sha512_fixedstring: [ OK ] 1.19 sec.
2026-07-15 21:39:09 01453_normalize_query_alias_uuid: [ OK ] 1.19 sec.
2026-07-15 21:39:11 03001_block_offset_column_2: [ OK ] 2.42 sec.
2026-07-15 21:39:13 03291_json_big_structure_deserialization: [ OK ] 100.00 sec.
2026-07-15 21:39:13 03167_base64_url_functions_sh: [ OK ] 158.97 sec.
2026-07-15 21:39:14 03020_output_format_client: [ OK ] 8.65 sec.
2026-07-15 21:39:15 03262_udf_in_constraint: [ OK ] 3.51 sec.
2026-07-15 21:39:20 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 6.26 sec.
2026-07-15 21:39:21 00980_merge_alter_settings: [ OK ] 5.72 sec.
2026-07-15 21:39:21 01802_formatDateTime_DateTime64_century: [ OK ] 1.61 sec.
2026-07-15 21:39:23 02490_replacing_merge_tree_is_deleted_column: [ OK ] 13.17 sec.
2026-07-15 21:39:24 01121_remote_scalar_subquery: [ OK ] 2.65 sec.
2026-07-15 21:39:24 00440_nulls_merge_tree: [ OK ] 2.51 sec.
2026-07-15 21:39:25 00098_f_union_all: [ OK ] 1.45 sec.
2026-07-15 21:39:26 00730_unicode_terminal_format: [ OK ] 2.66 sec.
2026-07-15 21:39:26 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 1.84 sec.
2026-07-15 21:39:26 02539_vertical_merge_compact_parts: [ OK ] 12.77 sec.
2026-07-15 21:39:27 01664_array_slice_ubsan: [ OK ] 1.02 sec.
2026-07-15 21:39:27 02316_values_table_func_bug: [ OK ] 1.02 sec.
2026-07-15 21:39:28 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 1.30 sec.
2026-07-15 21:39:29 00502_string_concat_with_array: [ OK ] 1.38 sec.
2026-07-15 21:39:30 03011_adaptative_timeout_compatibility: [ OK ] 1.05 sec.
2026-07-15 21:39:32 00688_aggregation_retention: [ OK ] 1.86 sec.
2026-07-15 21:39:33 01375_null_issue_3767: [ OK ] 1.19 sec.
2026-07-15 21:39:36 01307_orc_output_format: [ OK ] 8.90 sec.
2026-07-15 21:39:37 01079_new_range_reader_segfault: [ OK ] 1.27 sec.
2026-07-15 21:39:39 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 10.64 sec.
2026-07-15 21:39:40 01276_alter_rename_column_materialized_expr: [ OK ] 2.68 sec.
2026-07-15 21:39:40 03209_parameterized_view_with_non_literal_params: [ OK ] 6.85 sec.
2026-07-15 21:39:41 02932_query_settings_max_size_drop: [ OK ] 1.87 sec.
2026-07-15 21:39:41 00204_extract_url_parameter: [ OK ] 0.93 sec.
2026-07-15 21:39:42 01291_distributed_low_cardinality_memory_efficient: [ OK ] 1.46 sec.
2026-07-15 21:39:42 03038_nested_dynamic_merges_wide_vertical: [ SKIPPED ] 0.00 sec.
2026-07-15 21:39:42 Reason: not running for current build
2026-07-15 21:39:43 02711_server_uuid_macro: [ OK ] 2.40 sec.
2026-07-15 21:39:43 02536_date_from_number_inference_fix: [ OK ] 1.07 sec.
2026-07-15 21:39:44 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 2.09 sec.
2026-07-15 21:39:45 01058_zlib_ng_level1_bug: [ OK ] 19.27 sec.
2026-07-15 21:39:45 00054_join_string: [ OK ] 1.07 sec.
2026-07-15 21:39:45 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 1.93 sec.
2026-07-15 21:39:45 00048_b_stored_aggregates_merge: [ OK ] 2.00 sec.
2026-07-15 21:39:46 01720_union_distinct_with_limit: [ OK ] 0.97 sec.
2026-07-15 21:39:46 00860_unknown_identifier_bug: [ OK ] 1.25 sec.
2026-07-15 21:39:46 00725_join_on_bug_4: [ OK ] 1.56 sec.
2026-07-15 21:39:48 02813_func_today_and_alias: [ OK ] 1.54 sec.
2026-07-15 21:39:48 03015_aggregator_empty_data_multiple_blocks: [ OK ] 1.66 sec.
2026-07-15 21:39:48 03284_json_object_as_tuple_duplicate_keys: [ OK ] 1.91 sec.
2026-07-15 21:39:48 00961_check_table: [ OK ] 3.22 sec.
2026-07-15 21:39:50 00833_sleep_overflow: [ OK ] 0.97 sec.
2026-07-15 21:39:50 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 1.68 sec.
2026-07-15 21:39:51 01813_quantileBfloat16_nans: [ OK ] 1.02 sec.
2026-07-15 21:39:52 01277_large_tuples: [ OK ] 1.12 sec.
2026-07-15 21:39:52 02899_indexing_by_space_filling_curves: [ OK ] 4.28 sec.
2026-07-15 21:39:53 01220_scalar_optimization_in_alter: [ OK ] 1.14 sec.
2026-07-15 21:39:54 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 3.53 sec.
2026-07-15 21:39:55 02012_changed_enum_type_non_replicated: [ OK ] 1.50 sec.
2026-07-15 21:39:55 02016_bit_shift_right_for_string_integer: [ OK ] 6.62 sec.
2026-07-15 21:39:55 01890_state_of_state: [ OK ] 2.89 sec.
2026-07-15 21:39:56 01100_split_by_string: [ OK ] 1.23 sec.
2026-07-15 21:39:57 03152_join_filter_push_down_equivalent_columns: [ OK ] 1.99 sec.
2026-07-15 21:40:04 01648_mutations_and_escaping: [ OK ] 7.59 sec.
2026-07-15 21:40:04 02366_kql_operator_in_sql: [ OK ] 6.77 sec.
2026-07-15 21:40:05 00558_parse_floats: [ OK ] 0.89 sec.
2026-07-15 21:40:06 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 1.61 sec.
2026-07-15 21:40:06 03167_empty_tuple_concat: [ OK ] 0.92 sec.
2026-07-15 21:40:07 02192_comment: [ OK ] 1.22 sec.
2026-07-15 21:40:08 00809_add_days_segfault: [ OK ] 1.47 sec.
2026-07-15 21:40:08 00534_functions_bad_arguments2: [ OK ] 62.40 sec.
2026-07-15 21:40:09 00307_format_xml: [ OK ] 1.04 sec.
2026-07-15 21:40:10 01825_type_json_in_array: [ OK ] 2.54 sec.
2026-07-15 21:40:12 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 1.44 sec.
2026-07-15 21:40:12 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 17.67 sec.
2026-07-15 21:40:13 00988_parallel_parts_removal: [ OK ] 58.94 sec.
2026-07-15 21:40:14 02017_columns_with_dot_2: [ OK ] 1.87 sec.
2026-07-15 21:40:15 02831_trash: [ OK ] 1.21 sec.
2026-07-15 21:40:15 02540_date_column_consistent_insert_behaviour: [ OK ] 6.96 sec.
2026-07-15 21:40:16 01822_union_and_constans_error: [ OK ] 1.24 sec.
2026-07-15 21:40:16 00752_low_cardinality_permute: [ OK ] 1.51 sec.
2026-07-15 21:40:18 01355_CSV_input_format_allow_errors: [ OK ] 8.13 sec.
2026-07-15 21:40:18 01279_empty_external_table: [ OK ] 5.57 sec.
2026-07-15 21:40:19 01102_distributed_local_in_bug: [ OK ] 2.52 sec.
2026-07-15 21:40:20 01710_projections_and_duplicate_columms: [ OK ] 3.33 sec.
2026-07-15 21:40:20 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 2.52 sec.
2026-07-15 21:40:20 00725_join_on_bug_1: [ OK ] 1.74 sec.
2026-07-15 21:40:21 01492_format_readable_quantity: [ OK ] 1.13 sec.
2026-07-15 21:40:22 02813_seriesOutliersDetectTukey: [ OK ] 3.13 sec.
2026-07-15 21:40:22 02563_async_insert_bad_data: [ OK ] 8.16 sec.
2026-07-15 21:40:22 02915_analyzer_fuzz_1: [ OK ] 0.99 sec.
2026-07-15 21:40:23 03120_analyzer_param_in_CTE_alias: [ OK ] 1.06 sec.
2026-07-15 21:40:23 00393_if_with_constant_condition: [ OK ] 1.32 sec.
2026-07-15 21:40:23 01903_correct_block_size_prediction_with_default: [ OK ] 139.01 sec.
2026-07-15 21:40:24 01267_alter_default_key_columns_zookeeper_long: [ OK ] 3.09 sec.
2026-07-15 21:40:24 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 1.33 sec.
2026-07-15 21:40:24 03036_test_parquet_bloom_filter_push_down: [ OK ] 30.69 sec.
2026-07-15 21:40:25 00832_storage_file_lock: [ OK ] 1.08 sec.
2026-07-15 21:40:25 00002_system_numbers: [ OK ] 1.28 sec.
2026-07-15 21:40:27 02999_scalar_subqueries_bug_2: [ OK ] 1.62 sec.
2026-07-15 21:40:28 03008_filter_projections_non_deterministoc_functions: [ OK ] 4.69 sec.
2026-07-15 21:40:29 01457_int256_hashing: [ OK ] 2.63 sec.
2026-07-15 21:40:31 01034_unknown_qualified_column_in_join: [ OK ] 1.01 sec.
2026-07-15 21:40:31 03165_string_functions_with_token_text_indexes: [ OK ] 6.72 sec.
2026-07-15 21:40:32 01379_with_fill_several_columns: [ OK ] 1.18 sec.
2026-07-15 21:40:32 00369_int_div_of_float: [ OK ] 1.03 sec.
2026-07-15 21:40:33 03269_partition_key_not_in_set: [ OK ] 5.06 sec.
2026-07-15 21:40:33 01772_to_start_of_hour_align: [ OK ] 1.52 sec.
2026-07-15 21:40:34 01769_extended_range_2: [ OK ] 1.10 sec.
2026-07-15 21:40:34 00975_sample_prewhere_distributed: [ OK ] 1.70 sec.
2026-07-15 21:40:35 01413_truncate_without_table_keyword: [ OK ] 1.30 sec.
2026-07-15 21:40:35 00974_low_cardinality_cast: [ OK ] 1.18 sec.
2026-07-15 21:40:36 00938_fix_rwlock_segfault_long: [ OK ] 107.08 sec.
2026-07-15 21:40:36 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 2.14 sec.
2026-07-15 21:40:37 00487_if_array_fixed_string: [ OK ] 2.07 sec.
2026-07-15 21:40:38 00050_any_left_join: [ OK ] 0.94 sec.
2026-07-15 21:40:38 02124_insert_deduplication_token_materialized_views: [ OK ] 14.48 sec.
2026-07-15 21:40:38 02543_alter_update_rename_stuck: [ OK ] 13.29 sec.
2026-07-15 21:40:39 01881_create_as_tuple: [ OK ] 1.52 sec.
2026-07-15 21:40:39 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 1.11 sec.
2026-07-15 21:40:39 02342_window_view_different_struct: [ OK ] 3.59 sec.
2026-07-15 21:40:39 01610_client_spawn_editor: [ OK ] 0.46 sec.
2026-07-15 21:40:40 00752_low_cardinality_left_array_join: [ OK ] 1.90 sec.
2026-07-15 21:40:40 01084_regexp_empty: [ OK ] 1.12 sec.
2026-07-15 21:40:41 03005_input_function_in_join: [ OK ] 1.30 sec.
2026-07-15 21:40:41 00105_shard_collations: [ OK ] 3.48 sec.
2026-07-15 21:40:41 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 20.78 sec.
2026-07-15 21:40:42 02724_mutliple_storage_join: [ OK ] 1.11 sec.
2026-07-15 21:40:44 00700_decimal_aggregates: [ OK ] 8.75 sec.
2026-07-15 21:40:47 01799_long_uniq_theta_sketch: [ OK ] 23.57 sec.
2026-07-15 21:40:58 01353_nullable_tuple: [ OK ] 16.19 sec.
2026-07-15 21:40:59 01550_type_map_formats_input: [ OK ] 17.20 sec.
2026-07-15 21:41:04 02921_file_engine_size_virtual_column: [ OK ] 5.48 sec.
2026-07-15 21:41:05 01889_check_row_policy_defined_using_user_function: [ OK ] 19.99 sec.
2026-07-15 21:41:05 00996_neighbor: [ OK ] 6.17 sec.
2026-07-15 21:41:06 01683_intdiv_ubsan: [ OK ] 1.43 sec.
2026-07-15 21:41:18 01442_merge_detach_attach_long: [ OK ] 38.20 sec.
2026-07-15 21:41:18 02423_insert_stats_behaviour: [ OK ] 36.09 sec.
2026-07-15 21:41:20 02263_format_insert_settings: [ OK ] 13.63 sec.
2026-07-15 21:41:21 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 16.61 sec.
2026-07-15 21:41:21 01917_system_data_skipping_indices: [ OK ] 3.04 sec.
2026-07-15 21:41:22 00292_parser_tuple_element: [ OK ] 1.00 sec.
2026-07-15 21:41:22 03115_alias_exists_column: [ OK ] 1.38 sec.
2026-07-15 21:41:26 02741_hashed_dictionary_load_factor: [ OK ] 20.22 sec.
2026-07-15 21:41:27 01508_format_regexp_raw: [ OK ] 6.83 sec.
2026-07-15 21:41:29 00981_topK_topKWeighted_long: [ OK ] 48.65 sec.
2026-07-15 21:41:29 02933_ephemeral_mv: [ OK ] 2.54 sec.
2026-07-15 21:41:30 02021_exponential_sum_shard: [ OK ] 48.80 sec.
2026-07-15 21:41:30 02784_schema_inference_null_as_default: [ OK ] 1.11 sec.
2026-07-15 21:41:31 01825_type_json_2: [ OK ] 6.94 sec.
2026-07-15 21:41:34 02335_column_ttl_expired_column_optimization: [ OK ] 6.37 sec.
2026-07-15 21:41:36 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 6.37 sec.
2026-07-15 21:41:38 01710_projection_detach_part: [ OK ] 3.43 sec.
2026-07-15 21:41:39 00563_shard_insert_into_remote: [ OK ] 8.47 sec.
2026-07-15 21:41:40 02008_materialize_column: [ OK ] 9.98 sec.
2026-07-15 21:41:41 02526_kv_engine_different_filter_type: [ OK ] 5.24 sec.
2026-07-15 21:41:42 03095_join_filter_push_down_right_stream_filled: [ OK ] 2.85 sec.
2026-07-15 21:41:43 03144_invalid_filter: [ OK ] 2.27 sec.
2026-07-15 21:41:44 01771_datetime64_no_time_part: [ OK ] 1.75 sec.
2026-07-15 21:41:45 02861_interpolate_alias_precedence: [ OK ] 3.18 sec.
2026-07-15 21:41:47 03010_read_system_parts_table_test: [ OK ] 4.18 sec.
2026-07-15 21:41:48 01079_bit_operations_using_bitset: [ OK ] 3.20 sec.
2026-07-15 21:41:49 01024__getScalar: [ OK ] 1.11 sec.
2026-07-15 21:41:54 01096_zeros: [ OK ] 4.93 sec.
2026-07-15 21:41:58 02456_alter-nullable-column-bag-2: [ OK ] 3.86 sec.
2026-07-15 21:41:59 00652_replicated_mutations_default_database_zookeeper: [ OK ] 9.82 sec.
2026-07-15 21:42:01 01009_insert_select_data_loss: [ OK ] 2.37 sec.
2026-07-15 21:42:05 00335_bom: [ OK ] 4.25 sec.
2026-07-15 21:42:08 00963_startsWith_force_primary_key: [ OK ] 2.18 sec.
2026-07-15 21:42:08 03033_set_index_in: [ OK ] 24.32 sec.
2026-07-15 21:42:10 01937_nested_chinese: [ OK ] 1.91 sec.
2026-07-15 21:42:12 02798_generic_transform: [ OK ] 1.94 sec.
2026-07-15 21:42:14 02811_invalid_embedded_rocksdb_create: [ OK ] 1.04 sec.
2026-07-15 21:42:15 01460_line_as_string_format: [ OK ] 52.57 sec.
2026-07-15 21:42:16 02711_trim_aliases: [ OK ] 1.11 sec.
2026-07-15 21:42:17 02131_used_row_policies_in_query_log: [ OK ] 8.95 sec.
2026-07-15 21:42:17 02933_group_by_memory_usage: [ OK ] 59.29 sec.
2026-07-15 21:42:17 00900_orc_arrow_parquet_tuples: [ OK ] 18.30 sec.
2026-07-15 21:42:17 02952_clickhouse_local_query_parameters_cli: [ OK ] 3.61 sec.
2026-07-15 21:42:18 01273_arrow_dictionaries_load: [ OK ] 91.53 sec.
2026-07-15 21:42:18 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec.
2026-07-15 21:42:18 Reason: not running for current build
2026-07-15 21:42:18 03001_data_version_column: [ OK ] 1.55 sec.
2026-07-15 21:42:19 01851_hedged_connections_external_tables: [ OK ] 1.47 sec.
2026-07-15 21:42:19 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec.
2026-07-15 21:42:19 Reason: not running for current build
2026-07-15 21:42:20 03003_functions_to_subcolumns_final: [ OK ] 2.03 sec.
2026-07-15 21:42:20 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 3.77 sec.
2026-07-15 21:42:20 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 2.00 sec.
2026-07-15 21:42:21 03079_analyzer_numeric_literals_as_column_names: [ OK ] 2.01 sec.
2026-07-15 21:42:21 02266_auto_add_nullable: [ OK ] 1.46 sec.
2026-07-15 21:42:21 00266_read_overflow_mode: [ OK ] 1.14 sec.
2026-07-15 21:42:22 02876_json_incomplete_types_as_strings_inference: [ OK ] 1.14 sec.
2026-07-15 21:42:23 02353_isnullable: [ OK ] 1.57 sec.
2026-07-15 21:42:23 01532_tuple_with_name_type: [ OK ] 2.28 sec.
2026-07-15 21:42:23 01710_projection_row_policy: [ OK ] 2.60 sec.
2026-07-15 21:42:24 02292_nested_not_flattened_detach: [ OK ] 1.03 sec.
2026-07-15 21:42:24 00999_nullable_nested_types_4877: [ OK ] 3.31 sec.
2026-07-15 21:42:24 02115_map_contains_analyzer: [ OK ] 1.27 sec.
2026-07-15 21:42:25 00700_decimal_formats: [ OK ] 1.81 sec.
2026-07-15 21:42:25 01318_alter_add_column_exists: [ OK ] 1.36 sec.
2026-07-15 21:42:26 00753_alter_destination_for_storage_buffer: [ OK ] 2.12 sec.
2026-07-15 21:42:27 03215_grant_current_grants: [ OK ] 9.94 sec.
2026-07-15 21:42:28 02141_clickhouse_local_interactive_table: [ OK ] 3.24 sec.
2026-07-15 21:42:29 02575_map_hashing_msan: [ OK ] 1.35 sec.
2026-07-15 21:42:29 02126_fix_filelog: [ OK ] 7.22 sec.
2026-07-15 21:42:30 02725_cnf_large_check: [ OK ] 1.90 sec.
2026-07-15 21:42:30 02477_age_date32: [ OK ] 3.51 sec.
2026-07-15 21:42:30 02908_table_ttl_dependency: [ OK ] 4.57 sec.
2026-07-15 21:42:31 03167_base64_url_functions: [ OK ] 1.56 sec.
2026-07-15 21:42:32 03203_fill_missed_subcolumns: [ OK ] 2.51 sec.
2026-07-15 21:42:32 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 1.05 sec.
2026-07-15 21:42:34 02916_csv_infer_numbers_from_strings: [ OK ] 0.97 sec.
2026-07-15 21:42:36 02911_system_symbols: [ OK ] 6.60 sec.
2026-07-15 21:42:37 03004_force_null_for_omitted: [ OK ] 3.21 sec.
2026-07-15 21:42:38 02472_segfault_expression_parser: [ OK ] 0.84 sec.
2026-07-15 21:42:38 03172_http_content_encoding: [ OK ] 5.90 sec.
2026-07-15 21:42:38 02877_optimize_read_in_order_from_view: [ OK ] 9.63 sec.
2026-07-15 21:42:39 02910_nullable_enum_cast: [ OK ] 1.02 sec.
2026-07-15 21:42:39 01085_extract_all_empty: [ OK ] 0.81 sec.
2026-07-15 21:42:40 01050_group_array_sample: [ OK ] 0.99 sec.
2026-07-15 21:42:40 02353_partition_prune_nullable_key: [ OK ] 0.95 sec.
2026-07-15 21:42:41 01622_constraints_simple_optimization: [ OK ] 5.11 sec.
2026-07-15 21:42:41 02024_compression_in_query: [ OK ] 11.09 sec.
2026-07-15 21:42:41 01268_mergine_sorted_limit: [ OK ] 1.00 sec.
2026-07-15 21:42:42 02735_array_map_array_of_tuples: [ OK ] 0.89 sec.
2026-07-15 21:42:42 02136_kill_scalar_queries: [ OK ] 3.82 sec.
2026-07-15 21:42:45 02366_kql_tabular: [ OK ] 2.76 sec.
2026-07-15 21:42:45 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:42:45 Reason: not running for current build
2026-07-15 21:42:45 01710_projection_optimize_materialize: [ OK ] 2.90 sec.
2026-07-15 21:42:46 02994_sanity_check_settings: [ OK ] 1.15 sec.
2026-07-15 21:42:47 02918_multif_for_nullable: [ OK ] 5.69 sec.
2026-07-15 21:42:47 02974_backup_query_format_null: [ OK ] 5.63 sec.
2026-07-15 21:42:47 01013_totals_without_aggregation: [ OK ] 1.05 sec.
2026-07-15 21:42:48 02515_analyzer_null_for_empty: [ OK ] 0.79 sec.
2026-07-15 21:42:48 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.84 sec.
2026-07-15 21:42:50 00980_zookeeper_merge_tree_alter_settings: [ OK ] 4.61 sec.
2026-07-15 21:42:52 02325_dates_schema_inference: [ OK ] 4.03 sec.
2026-07-15 21:42:58 01686_rocksdb: [ OK ] 5.42 sec.
2026-07-15 21:42:59 03153_dynamic_type_empty: [ OK ] 1.21 sec.
2026-07-15 21:43:02 01825_new_type_json_nbagames: [ OK ] 90.49 sec.
2026-07-15 21:43:03 01526_initial_query_id: [ OK ] 15.46 sec.
2026-07-15 21:43:04 03246_skipping_index_70108: [ OK ] 4.46 sec.
2026-07-15 21:43:04 00071_insert_fewer_columns: [ OK ] 2.65 sec.
2026-07-15 21:43:05 02783_parallel_replicas_trivial_count_optimization: [ OK ] 18.09 sec.
2026-07-15 21:43:06 00600_create_temporary_table_if_not_exists: [ OK ] 1.25 sec.
2026-07-15 21:43:06 03204_format_join_on: [ OK ] 3.06 sec.
2026-07-15 21:43:08 01812_optimize_skip_unused_shards_single_node: [ OK ] 1.79 sec.
2026-07-15 21:43:09 02983_empty_map: [ OK ] 15.24 sec.
2026-07-15 21:43:10 00688_low_cardinality_in: [ OK ] 4.23 sec.
2026-07-15 21:43:10 01144_multiword_data_types: [ OK ] 1.78 sec.
2026-07-15 21:43:11 02842_filesystem_cache_validate_path: [ OK ] 1.46 sec.
2026-07-15 21:43:12 00668_compare_arrays_silviucpp: [ OK ] 1.68 sec.
2026-07-15 21:43:13 03034_ddls_and_merges_with_unusual_maps: [ OK ] 8.67 sec.
2026-07-15 21:43:13 02049_lowcardinality_shortcircuit_crash: [ OK ] 2.58 sec.
2026-07-15 21:43:16 02114_bool_type: [ OK ] 5.33 sec.
2026-07-15 21:43:20 01780_column_sparse_distinct: [ OK ] 6.01 sec.
2026-07-15 21:43:20 01013_hex_decimal: [ OK ] 3.19 sec.
2026-07-15 21:43:22 03065_analyzer_cross_join_and_array_join: [ OK ] 1.81 sec.
2026-07-15 21:43:27 00936_crc_functions: [ OK ] 4.48 sec.
2026-07-15 21:43:27 03048_not_found_column_xxx_in_block: [ OK ] 6.70 sec.
2026-07-15 21:43:29 02122_parallel_formatting_Markdown: [ OK ] 23.23 sec.
2026-07-15 21:43:29 00837_minmax_index: [ OK ] 15.50 sec.
2026-07-15 21:43:31 02503_join_switch_alias_fuzz: [ OK ] 1.51 sec.
2026-07-15 21:43:32 00834_kill_mutation_replicated_zookeeper: [ OK ] 66.10 sec.
2026-07-15 21:43:32 00538_datediff_plural_units: [ OK ] 2.34 sec.
2026-07-15 21:43:32 02369_analyzer_array_join_function: [ OK ] 5.16 sec.
2026-07-15 21:43:34 00467_qualified_names: [ OK ] 2.45 sec.
2026-07-15 21:43:35 01611_string_to_low_cardinality_key_alter: [ OK ] 3.06 sec.
2026-07-15 21:43:37 01214_point_in_Mecca: [ OK ] 24.30 sec.
2026-07-15 21:43:37 02513_prewhere_combine_step_filters: [ OK ] 2.18 sec.
2026-07-15 21:43:38 02381_arrow_dict_to_lc: [ OK ] 3.15 sec.
2026-07-15 21:43:40 02124_encrypt_decrypt_nullable: [ OK ] 3.10 sec.
2026-07-15 21:43:42 02494_parser_string_binary_literal: [ OK ] 2.99 sec.
2026-07-15 21:43:42 00197_if_fixed_string: [ OK ] 1.85 sec.
2026-07-15 21:43:43 00299_stripe_log_multiple_inserts: [ OK ] 5.82 sec.
2026-07-15 21:43:43 01317_no_password_in_command_line: [ OK ] 12.42 sec.
2026-07-15 21:43:44 02374_in_tuple_index: [ OK ] 1.42 sec.
2026-07-15 21:43:45 03199_merge_filters_bug: [ OK ] 2.54 sec.
2026-07-15 21:43:45 02152_dictionary_date32_type: [ OK ] 1.70 sec.
2026-07-15 21:43:46 02242_if_then_else_null_bug: [ OK ] 1.25 sec.
2026-07-15 21:43:48 01825_new_type_json_18: [ OK ] 1.59 sec.
2026-07-15 21:43:50 02469_interval_msan: [ OK ] 2.34 sec.
2026-07-15 21:43:51 02428_delete_with_settings: [ OK ] 5.35 sec.
2026-07-15 21:43:52 03049_unknown_identifier_materialized_column: [ OK ] 1.68 sec.
2026-07-15 21:43:53 00834_date_datetime_cmp: [ OK ] 1.30 sec.
2026-07-15 21:43:54 00589_removal_unused_columns_aggregation: [ OK ] 3.02 sec.
2026-07-15 21:43:54 02550_client_connections_credentials: [ OK ] 26.81 sec.
2026-07-15 21:43:55 01576_alter_low_cardinality_and_select: [ OK ] 13.52 sec.
2026-07-15 21:43:56 02421_new_type_json_async_insert: [ OK ] 11.30 sec.
2026-07-15 21:43:57 02693_multiple_joins_in: [ OK ] 1.82 sec.
2026-07-15 21:43:59 00520_tuple_values_interpreter: [ OK ] 2.12 sec.
2026-07-15 21:44:00 02177_merge_optimize_aggregation_in_order: [ OK ] 4.29 sec.
2026-07-15 21:44:00 01036_union_different_columns: [ OK ] 1.02 sec.
2026-07-15 21:44:01 00041_big_array_join: [ OK ] 7.36 sec.
2026-07-15 21:44:02 02872_prewhere_filter: [ OK ] 2.10 sec.
2026-07-15 21:44:03 02718_cli_dashed_options_parsing: [ OK ] 8.55 sec.
2026-07-15 21:44:04 02809_has_token: [ OK ] 0.99 sec.
2026-07-15 21:44:05 00280_hex_escape_sequence: [ OK ] 0.96 sec.
2026-07-15 21:44:05 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 4.14 sec.
2026-07-15 21:44:06 01089_alter_settings_old_format: [ OK ] 1.43 sec.
2026-07-15 21:44:07 02013_bloom_filter_hasAll: [ OK ] 3.90 sec.
2026-07-15 21:44:08 01825_type_json_3: [ OK ] 7.51 sec.
2026-07-15 21:44:08 02387_parse_date_as_datetime: [ OK ] 1.71 sec.
2026-07-15 21:44:09 00148_summing_merge_tree_aggregate_function: [ OK ] 36.82 sec.
2026-07-15 21:44:09 01514_input_format_json_enum_as_number: [ OK ] 1.64 sec.
2026-07-15 21:44:10 01846_alter_column_without_type_bugfix: [ OK ] 1.33 sec.
2026-07-15 21:44:10 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 4.17 sec.
2026-07-15 21:44:10 01549_low_cardinality_mv_fuzz: [ OK ] 1.34 sec.
2026-07-15 21:44:11 03217_datetime64_constant_to_ast: [ OK ] 1.26 sec.
2026-07-15 21:44:11 00927_disable_hyperscan: [ OK ] 1.99 sec.
2026-07-15 21:44:12 03084_analyzer_join_column_alias: [ OK ] 1.64 sec.
2026-07-15 21:44:13 00591_columns_removal_union_all: [ OK ] 1.23 sec.
2026-07-15 21:44:13 03140_client_subsequent_external_tables: [ OK ] 3.54 sec.
2026-07-15 21:44:14 02915_sleep_large_uint: [ OK ] 1.75 sec.
2026-07-15 21:44:15 00814_parsing_ub: [ OK ] 1.44 sec.
2026-07-15 21:44:16 02474_extract_fixedstring_from_json: [ OK ] 3.28 sec.
2026-07-15 21:44:17 00687_insert_into_mv: [ OK ] 5.92 sec.
2026-07-15 21:44:17 01774_bar_with_illegal_value: [ OK ] 1.23 sec.
2026-07-15 21:44:18 02874_analysis_of_variance_overflow: [ OK ] 1.71 sec.
2026-07-15 21:44:19 02911_add_index_and_materialize_index: [ OK ] 1.86 sec.
2026-07-15 21:44:20 01131_max_rows_to_sort: [ OK ] 2.05 sec.
2026-07-15 21:44:20 02888_obsolete_settings: [ OK ] 1.89 sec.
2026-07-15 21:44:22 00779_all_right_join_max_block_size: [ OK ] 1.36 sec.
2026-07-15 21:44:22 02890_describe_table_options: [ OK ] 2.69 sec.
2026-07-15 21:44:23 00952_part_frozen_info: [ OK ] 3.28 sec.
2026-07-15 21:44:23 01634_summap_nullable: [ OK ] 1.22 sec.
2026-07-15 21:44:24 03015_with_fill_invalid_expression: [ OK ] 1.16 sec.
2026-07-15 21:44:25 02364_dictionary_datetime_64_attribute_crash: [ OK ] 1.67 sec.
2026-07-15 21:44:27 02231_hierarchical_dictionaries_constant: [ OK ] 4.02 sec.
2026-07-15 21:44:30 01866_bit_positions_to_array: [ OK ] 4.49 sec.
2026-07-15 21:44:30 01710_projection_with_mixed_pipeline: [ OK ] 3.02 sec.
2026-07-15 21:44:32 03214_count_distinct_null_key_memory_leak: [ OK ] 22.13 sec.
2026-07-15 21:44:33 01413_alter_update_supertype: [ OK ] 2.71 sec.
2026-07-15 21:44:34 02723_jit_aggregation_bug_48120: [ OK ] 3.77 sec.
2026-07-15 21:44:34 03094_one_thousand_joins: [ OK ] 175.79 sec.
2026-07-15 21:44:34 02675_sparse_columns_clear_column: [ OK ] 21.15 sec.
2026-07-15 21:44:35 01463_resample_overflow: [ OK ] 0.85 sec.
2026-07-15 21:44:35 01951_distributed_push_down_limit: [ OK ] 1.02 sec.
2026-07-15 21:44:36 00760_insert_json_with_defaults: [ OK ] 3.45 sec.
2026-07-15 21:44:36 02995_preliminary_filters_duplicated_columns: [ OK ] 1.22 sec.
2026-07-15 21:44:37 03215_view_with_recursive: [ OK ] 3.21 sec.
2026-07-15 21:44:37 01783_parallel_formatting_memory: [ OK ] 3.29 sec.
2026-07-15 21:44:38 03033_analyzer_resolve_from_parent_scope: [ OK ] 2.04 sec.
2026-07-15 21:44:38 00252_shard_global_in_aggregate_function: [ OK ] 2.08 sec.
2026-07-15 21:44:39 01586_columns_pruning: [ OK ] 2.41 sec.
2026-07-15 21:44:39 02385_analyzer_aliases_compound_expression: [ OK ] 1.42 sec.
2026-07-15 21:44:40 02809_prewhere_and_in: [ OK ] 2.67 sec.
2026-07-15 21:44:40 01352_generate_random_overflow: [ OK ] 1.01 sec.
2026-07-15 21:44:40 00409_shard_limit_by: [ OK ] 2.72 sec.
2026-07-15 21:44:41 02677_grace_hash_limit_race: [ OK ] 1.53 sec.
2026-07-15 21:44:42 02766_bitshift_with_const_arguments: [ OK ] 1.87 sec.
2026-07-15 21:44:42 02351_Map_combinator_dist: [ OK ] 2.87 sec.
2026-07-15 21:44:42 01473_system_events_zeroes: [ OK ] 1.06 sec.
2026-07-15 21:44:43 02722_matcher_join_use_nulls: [ OK ] 5.98 sec.
2026-07-15 21:44:44 02010_array_index_bad_cast: [ OK ] 1.08 sec.
2026-07-15 21:44:44 03261_sort_cursor_crash: [ OK ] 1.90 sec.
2026-07-15 21:44:45 00315_quantile_off_by_one: [ OK ] 1.21 sec.
2026-07-15 21:44:45 01186_conversion_to_nullable: [ OK ] 1.30 sec.
2026-07-15 21:44:46 02181_format_describe_query: [ OK ] 3.23 sec.
2026-07-15 21:44:46 02415_all_new_functions_must_be_documented: [ OK ] 1.00 sec.
2026-07-15 21:44:46 02812_subquery_operators: [ OK ] 1.43 sec.
2026-07-15 21:44:48 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 24.00 sec.
2026-07-15 21:44:48 02534_join_prewhere_bug: [ OK ] 2.06 sec.
2026-07-15 21:44:49 02990_format_select_from_explain: [ OK ] 3.01 sec.
2026-07-15 21:44:50 00902_entropy: [ OK ] 1.79 sec.
2026-07-15 21:44:50 02751_multiquery_with_argument: [ OK ] 10.20 sec.
2026-07-15 21:44:52 01925_merge_prewhere_table: [ OK ] 1.44 sec.
2026-07-15 21:44:54 01710_projections_group_by_no_key: [ OK ] 1.77 sec.
2026-07-15 21:44:54 00354_host_command_line_option: [ OK ] 5.65 sec.
2026-07-15 21:44:55 02494_analyzer_compound_expression_crash_fix: [ OK ] 1.19 sec.
2026-07-15 21:44:58 00495_reading_const_zero_column: [ OK ] 2.07 sec.
2026-07-15 21:44:58 00910_client_window_size_detection: [ OK ] 4.01 sec.
2026-07-15 21:45:00 02122_parallel_formatting_Values: [ OK ] 13.22 sec.
2026-07-15 21:45:01 02245_s3_schema_desc: [ OK ] 3.26 sec.
2026-07-15 21:45:02 01414_low_cardinality_nullable: [ OK ] 12.54 sec.
2026-07-15 21:45:03 00141_parse_timestamp_as_datetime: [ OK ] 1.39 sec.
2026-07-15 21:45:05 02352_interactive_queries_from_file: [ OK ] 4.78 sec.
2026-07-15 21:45:06 03142_untuple_crash: [ OK ] 1.01 sec.
2026-07-15 21:45:08 00702_join_on_dups: [ OK ] 9.57 sec.
2026-07-15 21:45:08 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 5.51 sec.
2026-07-15 21:45:11 01090_fixed_string_bit_ops: [ OK ] 1.62 sec.
2026-07-15 21:45:12 03037_dot_product_overflow: [ OK ] 1.50 sec.
2026-07-15 21:45:13 02016_agg_empty_result_bug_28880: [ OK ] 5.23 sec.
2026-07-15 21:45:14 01415_sticking_mutations: [ OK ] 77.02 sec.
2026-07-15 21:45:14 01825_type_json_16: [ OK ] 11.85 sec.
2026-07-15 21:45:15 01849_geoToS2: [ OK ] 8.39 sec.
2026-07-15 21:45:16 01472_many_rows_in_totals: [ OK ] 3.01 sec.
2026-07-15 21:45:16 02381_parseDateTime64BestEffortUS: [ OK ] 2.28 sec.
2026-07-15 21:45:16 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 1.56 sec.
2026-07-15 21:45:18 02797_range_nullable: [ OK ] 3.01 sec.
2026-07-15 21:45:18 03040_array_sum_and_join: [ OK ] 2.61 sec.
2026-07-15 21:45:20 02922_server_exit_code: [ OK ] 3.27 sec.
2026-07-15 21:45:21 02372_now_in_block: [ OK ] 2.64 sec.
2026-07-15 21:45:24 01595_countMatches: [ OK ] 5.82 sec.
2026-07-15 21:45:25 02882_formatQuery: [ OK ] 7.79 sec.
2026-07-15 21:45:34 00530_arrays_of_nothing: [ OK ] 6.09 sec.
2026-07-15 21:45:44 02735_system_zookeeper_connection: [ OK ] 19.22 sec.
2026-07-15 21:45:46 00515_shard_desc_table_functions_and_subqueries: [ OK ] 11.46 sec.
2026-07-15 21:45:49 02883_zookeeper_finalize_stress: [ OK ] 29.22 sec.
2026-07-15 21:45:55 02366_kql_func_math: [ OK ] 4.51 sec.
2026-07-15 21:45:55 02311_range_hashed_dictionary_range_cast: [ OK ] 9.08 sec.
2026-07-15 21:45:59 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 12.67 sec.
2026-07-15 21:46:02 02371_create_temporary_table_as_with_columns_list: [ OK ] 2.05 sec.
2026-07-15 21:46:04 00034_fixed_string_to_number: [ OK ] 1.18 sec.
2026-07-15 21:46:06 03164_early_constant_folding_analyzer: [ OK ] 2.24 sec.
2026-07-15 21:46:08 02025_storage_filelog_virtual_col: [ OK ] 46.80 sec.
2026-07-15 21:46:08 02496_remove_redundant_sorting: [ OK ] 79.30 sec.
2026-07-15 21:46:10 00623_in_partition_key: [ OK ] 13.98 sec.
2026-07-15 21:46:11 02520_group_array_last: [ OK ] 15.46 sec.
2026-07-15 21:46:12 00448_to_string_cut_to_zero: [ OK ] 2.14 sec.
2026-07-15 21:46:14 02922_respect_nulls_Nullable: [ OK ] 5.19 sec.
2026-07-15 21:46:14 00700_decimal_math: [ OK ] 5.68 sec.
2026-07-15 21:46:14 03197_storage_join_strictness_type_restriction: [ OK ] 1.55 sec.
2026-07-15 21:46:17 03038_recursive_cte_postgres_4: [ OK ] 10.17 sec.
2026-07-15 21:46:18 01417_update_permutation_crash: [ OK ] 3.55 sec.
2026-07-15 21:46:18 02296_nullable_arguments_in_array_filter: [ OK ] 3.61 sec.
2026-07-15 21:46:18 01940_custom_tld_sharding_key: [ OK ] 3.69 sec.
2026-07-15 21:46:20 02355_column_type_name_lc: [ OK ] 1.57 sec.
2026-07-15 21:46:20 01413_if_array_uuid: [ OK ] 1.79 sec.
2026-07-15 21:46:22 02833_tuple_concat: [ OK ] 5.07 sec.
2026-07-15 21:46:22 02131_skip_index_not_materialized: [ OK ] 3.78 sec.
2026-07-15 21:46:24 02121_pager: [ OK ] 4.20 sec.
2026-07-15 21:46:26 02751_protobuf_ipv6: [ OK ] 3.63 sec.
2026-07-15 21:46:26 00969_columns_clause: [ OK ] 3.36 sec.
2026-07-15 21:46:26 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2026-07-15 21:46:26 Reason: not running for current build
2026-07-15 21:46:29 01082_bit_test_out_of_bound: [ OK ] 2.91 sec.
2026-07-15 21:46:30 02293_http_header_full_summary_without_progress: [ OK ] 3.83 sec.
2026-07-15 21:46:32 03199_join_with_materialized_column: [ OK ] 1.39 sec.
2026-07-15 21:46:33 01710_projection_external_aggregate: [ OK ] 12.06 sec.
2026-07-15 21:46:33 02959_system_database_engines: [ OK ] 1.05 sec.
2026-07-15 21:46:34 01012_select_limit_x_0: [ OK ] 1.26 sec.
2026-07-15 21:46:34 00464_array_element_out_of_range: [ OK ] 1.12 sec.
2026-07-15 21:46:37 02988_join_using_prewhere_pushdown: [ OK ] 3.00 sec.
2026-07-15 21:46:38 01922_array_join_with_index: [ OK ] 3.28 sec.
2026-07-15 21:46:43 02792_drop_projection_lwd: [ OK ] 5.17 sec.
2026-07-15 21:46:48 02725_object_column_alter: [ OK ] 4.30 sec.
2026-07-15 21:46:51 00626_replace_partition_from_table: [ OK ] 25.18 sec.
2026-07-15 21:46:54 00052_all_left_join: [ OK ] 3.39 sec.
2026-07-15 21:46:55 01015_empty_in_inner_right_join: [ OK ] 17.31 sec.
2026-07-15 21:47:01 02003_compress_bz2: [ OK ] 5.32 sec.
2026-07-15 21:47:03 02862_sorted_distinct_sparse_fix: [ OK ] 8.69 sec.
2026-07-15 21:47:03 01020_having_without_group_by: [ OK ] 2.10 sec.
2026-07-15 21:47:05 01802_toDateTime64_large_values: [ OK ] 1.45 sec.
2026-07-15 21:47:06 02554_format_json_columns_for_empty: [ OK ] 1.65 sec.
2026-07-15 21:47:10 03006_mv_deduplication_throw_if_async_insert: [ OK ] 4.39 sec.
2026-07-15 21:47:16 01053_if_chain_check: [ OK ] 5.75 sec.
2026-07-15 21:47:19 02421_truncate_isolation_no_merges: [ OK ] 153.24 sec.
2026-07-15 21:47:19 00069_date_arithmetic: [ OK ] 3.00 sec.
2026-07-15 21:47:21 02535_analyzer_limit_offset: [ OK ] 1.16 sec.
2026-07-15 21:47:25 02176_optimize_aggregation_in_order_empty: [ OK ] 4.11 sec.
2026-07-15 21:47:25 02987_group_array_intersect: [ OK ] 74.19 sec.
2026-07-15 21:47:27 01780_range_msan: [ OK ] 1.31 sec.
2026-07-15 21:47:31 02508_index_analysis_to_date_timezone: [ OK ] 4.01 sec.
2026-07-15 21:47:31 00930_arrayIntersect: [ OK ] 10.26 sec.
2026-07-15 21:47:31 01381_for_each_with_states: [ OK ] 2.86 sec.
2026-07-15 21:47:34 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 3.06 sec.
2026-07-15 21:47:36 01457_order_by_nulls_first: [ OK ] 4.72 sec.
2026-07-15 21:47:36 01602_modified_julian_day_msan: [ OK ] 1.80 sec.
2026-07-15 21:47:40 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 33.53 sec.
2026-07-15 21:47:42 03053_analyzer_join_alias: [ OK ] 1.59 sec.
2026-07-15 21:47:43 00834_not_between: [ OK ] 1.55 sec.
2026-07-15 21:47:51 03135_keeper_client_find_commands: [ OK ] 7.92 sec.
2026-07-15 21:47:54 02714_date_date32_in: [ OK ] 2.67 sec.
2026-07-15 21:47:57 02481_async_insert_dedup: [ OK ] 160.21 sec.
2026-07-15 21:47:58 00586_removing_unused_columns_from_subquery: [ OK ] 20.90 sec.
2026-07-15 21:47:59 01060_window_view_event_tumble_to_asc: [ OK ] 27.99 sec.
2026-07-15 21:47:59 02554_invalid_create_view_syntax: [ OK ] 0.94 sec.
2026-07-15 21:47:59 01710_projection_with_nullable_keys: [ OK ] 2.35 sec.
2026-07-15 21:48:00 01825_type_json_nbagames: [ OK ] 71.67 sec.
2026-07-15 21:48:02 00957_delta_diff_bug: [ OK ] 2.39 sec.
2026-07-15 21:48:03 02479_if_with_null_and_cullable_const: [ OK ] 1.35 sec.
2026-07-15 21:48:03 01710_minmax_count_projection_modify_partition_key: [ OK ] 3.99 sec.
2026-07-15 21:48:04 02312_parquet_orc_arrow_names_tuples: [ OK ] 9.07 sec.
2026-07-15 21:48:05 03173_distinct_combinator_alignment: [ OK ] 1.50 sec.
2026-07-15 21:48:08 01071_force_optimize_skip_unused_shards: [ OK ] 7.86 sec.
2026-07-15 21:48:10 01902_table_function_merge_db_params: [ OK ] 2.00 sec.
2026-07-15 21:48:11 02811_csv_input_field_type_mismatch: [ OK ] 6.68 sec.
2026-07-15 21:48:11 01710_projection_group_by_order_by: [ OK ] 0.91 sec.
2026-07-15 21:48:12 01664_decimal_ubsan: [ OK ] 1.12 sec.
2026-07-15 21:48:15 02918_gorilla_invalid_file: [ OK ] 2.74 sec.
2026-07-15 21:48:15 03161_decimal_binary_math: [ OK ] 10.26 sec.
2026-07-15 21:48:16 01753_optimize_aggregation_in_order: [ OK ] 5.01 sec.
2026-07-15 21:48:18 03010_view_prewhere_in: [ OK ] 2.64 sec.
2026-07-15 21:48:20 02891_rename_table_without_keyword: [ OK ] 3.16 sec.
2026-07-15 21:48:21 00564_initial_column_values_with_default_expression: [ OK ] 1.92 sec.
2026-07-15 21:48:23 00825_protobuf_format_squares: [ OK ] 7.65 sec.
2026-07-15 21:48:23 00443_optimize_final_vertical_merge: [ OK ] 113.26 sec.
2026-07-15 21:48:23 03038_move_partition_to_oneself_deadlock: [ OK ] 1.93 sec.
2026-07-15 21:48:24 02381_parse_array_of_tuples: [ OK ] 1.54 sec.
2026-07-15 21:48:27 00652_replicated_mutations_zookeeper: [ OK ] 51.09 sec.
2026-07-15 21:48:27 00210_insert_select_extremes_http: [ OK ] 4.00 sec.
2026-07-15 21:48:28 01085_datetime_arithmetic_preserve_timezone: [ OK ] 1.05 sec.
2026-07-15 21:48:28 00650_array_enumerate_uniq_with_tuples: [ OK ] 3.87 sec.
2026-07-15 21:48:30 03158_dynamic_type_from_variant: [ OK ] 1.52 sec.
2026-07-15 21:48:31 03164_analyzer_validate_tree_size: [ OK ] 8.12 sec.
2026-07-15 21:48:38 00392_enum_nested_alter: [ OK ] 10.73 sec.
2026-07-15 21:48:39 01425_default_value_of_type_name: [ OK ] 1.21 sec.
2026-07-15 21:48:41 02790_fix_coredump_when_compile_expression: [ OK ] 1.39 sec.
2026-07-15 21:48:44 01497_mutation_support_for_storage_memory: [ OK ] 2.50 sec.
2026-07-15 21:48:56 03246_json_tuple_decompress_race: [ OK ] 11.05 sec.
2026-07-15 21:49:02 00753_quantile_format: [ OK ] 5.86 sec.
2026-07-15 21:49:06 01949_heredoc_unfinished: [ OK ] 3.43 sec.
2026-07-15 21:49:09 03113_analyzer_not_found_column_in_block_2: [ OK ] 2.79 sec.
2026-07-15 21:49:09 00763_long_lock_buffer_alter_destination_table: [ OK ] 38.81 sec.
2026-07-15 21:49:09 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:49:09 Reason: not running for current build
2026-07-15 21:49:20 02125_lz4_compression_bug_TSKV: [ OK ] 51.09 sec.
2026-07-15 21:49:20 02581_width_bucket: [ OK ] 9.45 sec.
2026-07-15 21:49:23 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 2.52 sec.
2026-07-15 21:49:23 00136_duplicate_order_by_elems: [ OK ] 2.72 sec.
2026-07-15 21:49:24 03208_array_of_json_read_subcolumns_1: [ OK ] 84.12 sec.
2026-07-15 21:49:24 00098_6_union_all: [ OK ] 1.02 sec.
2026-07-15 21:49:25 01423_if_nullable_cond: [ OK ] 1.07 sec.
2026-07-15 21:49:26 01583_parallel_parsing_exception_with_offset: [ OK ] 54.13 sec.
2026-07-15 21:49:27 02713_sequence_match_serialization_fix: [ OK ] 2.36 sec.
2026-07-15 21:49:29 01882_scalar_subquery_exception: [ OK ] 2.82 sec.
2026-07-15 21:49:29 03199_queries_with_new_analyzer: [ OK ] 3.27 sec.
2026-07-15 21:49:30 02533_generate_random_schema_inference: [ OK ] 1.34 sec.
2026-07-15 21:49:33 02185_arraySlice_negative_offset_size: [ OK ] 2.22 sec.
2026-07-15 21:49:34 00534_functions_bad_arguments1: [ OK ] 90.25 sec.
2026-07-15 21:49:35 02999_analyzer_preimage_null: [ OK ] 1.42 sec.
2026-07-15 21:49:36 00037_totals_limit: [ OK ] 1.10 sec.
2026-07-15 21:49:36 02995_index_3: [ SKIPPED ] 0.00 sec.
2026-07-15 21:49:36 Reason: not running for current build
2026-07-15 21:49:39 02915_fpc_overflow: [ OK ] 2.64 sec.
2026-07-15 21:49:40 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 1.31 sec.
2026-07-15 21:49:41 01778_where_with_column_name: [ OK ] 1.01 sec.
2026-07-15 21:49:42 01171_mv_select_insert_isolation_long: [ OK ] 421.51 sec.
2026-07-15 21:49:42 01249_flush_interactive: [ OK ] 12.66 sec.
2026-07-15 21:49:42 03002_modify_query_cte: [ OK ] 1.11 sec.
2026-07-15 21:49:45 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 2.63 sec.
2026-07-15 21:49:45 02714_async_inserts_empty_data: [ OK ] 18.25 sec.
2026-07-15 21:49:46 01049_join_low_card_bug_long: [ OK ] 86.09 sec.
2026-07-15 21:49:46 02290_client_insert_cancel: [ OK ] 4.16 sec.
2026-07-15 21:49:46 00151_tuple_with_array: [ OK ] 1.03 sec.
2026-07-15 21:49:48 00752_low_cardinality_lambda_argument: [ OK ] 2.34 sec.
2026-07-15 21:49:49 02286_tuple_numeric_identifier: [ OK ] 2.43 sec.
2026-07-15 21:49:49 00862_decimal_in: [ OK ] 2.71 sec.
2026-07-15 21:49:50 02302_clash_const_aggegate_join: [ OK ] 2.25 sec.
2026-07-15 21:49:50 03263_analyzer_materialized_view_cte_nested: [ OK ] 1.62 sec.
2026-07-15 21:49:51 00839_bitmask_negative: [ OK ] 1.57 sec.
2026-07-15 21:49:52 03130_analyzer_self_join_group_by: [ OK ] 1.47 sec.
2026-07-15 21:49:52 01825_new_type_json_distributed: [ OK ] 1.42 sec.
2026-07-15 21:49:53 00950_test_gorilla_codec: [ OK ] 2.47 sec.
2026-07-15 21:49:53 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 1.61 sec.
2026-07-15 21:49:55 02008_test_union_distinct_in_subquery: [ OK ] 2.68 sec.
2026-07-15 21:49:55 03166_mv_prewhere_duplicating_name_bug: [ OK ] 1.09 sec.
2026-07-15 21:49:56 02885_create_distributed_table_without_as: [ OK ] 1.31 sec.
2026-07-15 21:49:57 02267_empty_arrays_read_reverse: [ OK ] 3.29 sec.
2026-07-15 21:49:57 02113_base64encode_trailing_bytes_1: [ OK ] 0.81 sec.
2026-07-15 21:49:58 00513_fractional_time_zones: [ OK ] 0.87 sec.
2026-07-15 21:50:01 03131_rewrite_sum_if_nullable: [ OK ] 2.98 sec.
2026-07-15 21:50:02 01710_projections_optimize_aggregation_in_order: [ OK ] 39.45 sec.
2026-07-15 21:50:03 03010_sum_to_to_count_if_nullable: [ OK ] 2.01 sec.
2026-07-15 21:50:03 02572_max_intersections: [ OK ] 0.95 sec.
2026-07-15 21:50:04 02876_yyyymmddhhmmsstodatetime: [ OK ] 6.77 sec.
2026-07-15 21:50:04 02972_to_string_nullable_timezone: [ OK ] 0.95 sec.
2026-07-15 21:50:05 03217_fliter_pushdown_no_keys: [ OK ] 1.41 sec.
2026-07-15 21:50:07 02895_npy_format: [ OK ] 32.77 sec.
2026-07-15 21:50:08 02807_lower_utf8_msan: [ OK ] 1.04 sec.
2026-07-15 21:50:11 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 5.45 sec.
2026-07-15 21:50:11 01088_benchmark_query_id: [ OK ] 8.30 sec.
2026-07-15 21:50:12 02810_row_binary_with_defaults: [ OK ] 1.12 sec.
2026-07-15 21:50:17 02764_csv_trim_whitespaces: [ OK ] 67.73 sec.
2026-07-15 21:50:17 01903_http_fields: [ OK ] 5.96 sec.
2026-07-15 21:50:18 01925_json_as_string_data_in_square_brackets: [ OK ] 1.14 sec.
2026-07-15 21:50:18 02347_rank_corr_nan: [ OK ] 1.19 sec.
2026-07-15 21:50:18 02354_read_in_order_prewhere: [ OK ] 13.62 sec.
2026-07-15 21:50:18 00719_parallel_ddl_db: [ OK ] 31.60 sec.
2026-07-15 21:50:19 03006_async_insert_deadlock_log: [ OK ] 6.62 sec.
2026-07-15 21:50:20 00696_system_columns_limit: [ OK ] 1.69 sec.
2026-07-15 21:50:20 00753_comment_columns_zookeeper: [ OK ] 1.74 sec.
2026-07-15 21:50:20 02575_merge_prewhere_materialized: [ OK ] 2.19 sec.
2026-07-15 21:50:21 02902_topKGeneric_deserialization_memory: [ OK ] 1.49 sec.
2026-07-15 21:50:22 02688_long_aggregate_function_names: [ OK ] 1.20 sec.
2026-07-15 21:50:25 03032_storage_memory_modify_settings: [ OK ] 5.21 sec.
2026-07-15 21:50:26 00847_multiple_join_same_column: [ OK ] 3.82 sec.
2026-07-15 21:50:28 02418_keeper_map_keys_limit: [ OK ] 2.32 sec.
2026-07-15 21:50:28 03033_lightweight_deletes_sync: [ OK ] 2.16 sec.
2026-07-15 21:50:29 02409_url_format_detection: [ OK ] 1.15 sec.
2026-07-15 21:50:34 03169_time_virtual_column: [ OK ] 4.20 sec.
2026-07-15 21:50:40 02896_leading_zeroes_no_octal: [ OK ] 21.65 sec.
2026-07-15 21:50:41 02907_preferred_optimize_projection_name: [ OK ] 32.63 sec.
2026-07-15 21:50:41 03043_group_array_result_is_expected: [ OK ] 1.21 sec.
2026-07-15 21:50:42 00098_j_union_all: [ OK ] 1.25 sec.
2026-07-15 21:50:43 02150_replace_regexp_all_empty_match: [ OK ] 1.02 sec.
2026-07-15 21:50:46 01721_join_implicit_cast_long: [ OK ] 63.59 sec.
2026-07-15 21:50:47 00753_alter_attach: [ OK ] 12.61 sec.
2026-07-15 21:50:47 02243_make_date32: [ OK ] 6.00 sec.
2026-07-15 21:50:48 01410_nullable_key_and_index: [ OK ] 4.52 sec.
2026-07-15 21:50:48 02317_distinct_in_order_optimization_explain: [ OK ] 53.33 sec.
2026-07-15 21:50:50 02235_check_table_sparse_serialization: [ OK ] 2.07 sec.
2026-07-15 21:50:51 03159_dynamic_type_all_types: [ OK ] 5.14 sec.
2026-07-15 21:50:52 02681_aggregation_by_partitions_bug: [ OK ] 5.19 sec.
2026-07-15 21:50:54 02474_fix_function_parser_bug: [ OK ] 1.05 sec.
2026-07-15 21:50:54 00927_asof_join_noninclusive: [ OK ] 6.03 sec.
2026-07-15 21:50:55 03154_recursive_cte_distributed: [ OK ] 4.37 sec.
2026-07-15 21:50:55 02531_ipv4_arithmetic: [ OK ] 1.06 sec.
2026-07-15 21:50:55 01528_setting_aggregate_functions_null_for_empty: [ OK ] 3.59 sec.
2026-07-15 21:50:55 00114_float_type_result_of_division: [ OK ] 0.92 sec.
2026-07-15 21:50:55 02801_backup_native_copy: [ OK ] 34.78 sec.
2026-07-15 21:50:56 02816_check_projection_metadata: [ OK ] 1.21 sec.
2026-07-15 21:50:57 00218_like_regexp_newline: [ OK ] 1.45 sec.
2026-07-15 21:50:57 01355_alter_column_with_order: [ OK ] 1.74 sec.
2026-07-15 21:50:57 01301_polygons_within: [ OK ] 1.72 sec.
2026-07-15 21:50:58 02679_query_parameters_dangling_pointer: [ OK ] 1.01 sec.
2026-07-15 21:50:58 01691_parser_data_type_exponential: [ OK ] 10.63 sec.
2026-07-15 21:50:58 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 1.50 sec.
2026-07-15 21:50:58 02556_local_with_totals_and_extremes: [ OK ] 3.00 sec.
2026-07-15 21:50:58 02179_range_hashed_dictionary_invalid_interval: [ OK ] 1.64 sec.
2026-07-15 21:50:59 00685_output_format_json_escape_forward_slashes: [ OK ] 0.99 sec.
2026-07-15 21:51:00 02982_comments_in_system_tables: [ OK ] 3.75 sec.
2026-07-15 21:51:01 02551_obfuscator_keywords: [ OK ] 2.98 sec.
2026-07-15 21:51:01 02833_local_udf_options: [ OK ] 2.98 sec.
2026-07-15 21:51:02 02030_client_unknown_database: [ OK ] 3.25 sec.
2026-07-15 21:51:02 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.96 sec.
2026-07-15 21:51:03 01913_fix_column_transformer_replace_format: [ OK ] 0.95 sec.
2026-07-15 21:51:03 03221_mutate_profile_events: [ OK ] 5.06 sec.
2026-07-15 21:51:03 01492_array_join_crash_13829: [ OK ] 1.01 sec.
2026-07-15 21:51:04 03152_dynamic_type_simple: [ OK ] 1.58 sec.
2026-07-15 21:51:04 02933_compare_with_bool_as_string: [ OK ] 0.91 sec.
2026-07-15 21:51:04 03040_dynamic_type_alters_1_memory: [ OK ] 3.91 sec.
2026-07-15 21:51:05 01851_clear_column_referenced_by_mv: [ OK ] 1.31 sec.
2026-07-15 21:51:05 01812_has_generic: [ OK ] 1.06 sec.
2026-07-15 21:51:06 02097_initializeAggregationNullable: [ OK ] 1.11 sec.
2026-07-15 21:51:06 01825_type_json_missed_values: [ OK ] 1.61 sec.
2026-07-15 21:51:06 03217_filtering_in_storage_merge: [ OK ] 1.62 sec.
2026-07-15 21:51:07 01631_date_overflow_as_partition_key: [ OK ] 1.32 sec.
2026-07-15 21:51:08 00534_exp10: [ OK ] 1.56 sec.
2026-07-15 21:51:10 00527_totals_having_nullable: [ OK ] 2.23 sec.
2026-07-15 21:51:14 02206_clickhouse_local_use_database: [ OK ] 3.08 sec.
2026-07-15 21:51:15 00729_prewhere_array_join: [ OK ] 9.43 sec.
2026-07-15 21:51:16 02133_distributed_queries_formatting: [ OK ] 2.01 sec.
2026-07-15 21:51:17 00712_prewhere_with_alias_bug: [ OK ] 1.68 sec.
2026-07-15 21:51:20 01232_untuple: [ OK ] 3.07 sec.
2026-07-15 21:51:21 02122_parallel_formatting_JSONStrings: [ OK ] 18.07 sec.
2026-07-15 21:51:22 00910_buffer_prewhere: [ OK ] 1.45 sec.
2026-07-15 21:51:22 01915_json_extract_raw_string: [ OK ] 1.33 sec.
2026-07-15 21:51:23 00310_tskv: [ OK ] 7.00 sec.
2026-07-15 21:51:25 02990_arrayFold_nullable_lc: [ OK ] 2.44 sec.
2026-07-15 21:51:25 01412_row_from_totals: [ OK ] 2.30 sec.
2026-07-15 21:51:25 03168_query_log_privileges_not_empty: [ OK ] 27.42 sec.
2026-07-15 21:51:26 02734_big_int_from_float_ubsan: [ OK ] 0.93 sec.
2026-07-15 21:51:26 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec.
2026-07-15 21:51:26 Reason: not running for current build
2026-07-15 21:51:26 00712_nan_comparison: [ OK ] 2.81 sec.
2026-07-15 21:51:27 01773_min_max_time_system_parts_datetime64: [ OK ] 1.21 sec.
2026-07-15 21:51:27 00700_decimal_in_keys: [ OK ] 2.12 sec.
2026-07-15 21:51:29 01324_settings_documentation: [ OK ] 1.00 sec.
2026-07-15 21:51:31 03198_settings_in_csv_tsv_schema_cache: [ OK ] 4.78 sec.
2026-07-15 21:51:32 00276_sample: [ OK ] 23.97 sec.
2026-07-15 21:51:32 02122_4letter_words_stress_zookeeper: [ OK ] 26.06 sec.
2026-07-15 21:51:38 01183_custom_separated_format_http: [ OK ] 6.76 sec.
2026-07-15 21:51:39 03155_explain_current_transaction: [ OK ] 0.79 sec.
2026-07-15 21:51:41 00534_functions_bad_arguments11: [ OK ] 80.05 sec.
2026-07-15 21:51:41 02346_fulltext_index_bug47393: [ OK ] 1.26 sec.
2026-07-15 21:51:41 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.74 sec.
2026-07-15 21:51:42 01280_unicode_whitespaces_lexer: [ OK ] 0.95 sec.
2026-07-15 21:51:43 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 2.26 sec.
2026-07-15 21:51:43 01338_long_select_and_alter_zookeeper: [ OK ] 18.45 sec.
2026-07-15 21:51:44 00726_materialized_view_concurrent: [ OK ] 1.41 sec.
2026-07-15 21:51:45 01300_svg: [ OK ] 3.04 sec.
2026-07-15 21:51:46 01079_bad_alters_zookeeper_long: [ OK ] 15.84 sec.
2026-07-15 21:51:47 01047_no_alias_columns_with_table_aliases: [ OK ] 1.16 sec.
2026-07-15 21:51:47 01616_untuple_access_field: [ OK ] 0.84 sec.
2026-07-15 21:51:47 02480_tets_show_full: [ OK ] 4.03 sec.
2026-07-15 21:51:48 01940_totimezone_operator_monotonicity: [ OK ] 1.05 sec.
2026-07-15 21:51:49 01474_decimal_scale_bug: [ OK ] 1.40 sec.
2026-07-15 21:51:49 01509_parallel_quorum_and_merge_long: [ OK ] 20.35 sec.
2026-07-15 21:51:49 02564_read_in_order_final_desc: [ OK ] 1.32 sec.
2026-07-15 21:51:49 03287_dynamic_and_json_squashing_fix: [ OK ] 2.01 sec.
2026-07-15 21:51:51 01825_type_json_18: [ OK ] 1.18 sec.
2026-07-15 21:51:51 00910_decimal_group_array_crash_3783: [ OK ] 1.92 sec.
2026-07-15 21:51:52 00700_decimal_with_default_precision_and_scale: [ OK ] 0.91 sec.
2026-07-15 21:51:52 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 2.53 sec.
2026-07-15 21:51:52 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 7.76 sec.
2026-07-15 21:51:53 01535_decimal_round_scale_overflow_check: [ OK ] 0.84 sec.
2026-07-15 21:51:53 00578_merge_table_sampling: [ OK ] 1.44 sec.
2026-07-15 21:51:55 02461_alter_update_respect_part_column_type_bug: [ OK ] 5.54 sec.
2026-07-15 21:51:56 02183_dictionary_date_types: [ OK ] 3.70 sec.
2026-07-15 21:51:56 02184_ipv6_select_parsing: [ OK ] 1.00 sec.
2026-07-15 21:51:56 00161_rounding_functions: [ OK ] 3.27 sec.
2026-07-15 21:51:57 01761_cast_to_enum_nullable: [ OK ] 0.84 sec.
2026-07-15 21:51:57 01621_summap_check_types: [ OK ] 0.95 sec.
2026-07-15 21:51:58 03641_analyzer_issue_85834: [ OK ] 1.00 sec.
2026-07-15 21:51:59 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 1.24 sec.
2026-07-15 21:51:59 00926_adaptive_index_granularity_merge_tree: [ OK ] 8.19 sec.
2026-07-15 21:51:59 00964_bloom_index_string_functions: [ OK ] 27.35 sec.
2026-07-15 21:52:00 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 1.82 sec.
2026-07-15 21:52:01 00900_orc_arrays_load: [ OK ] 7.48 sec.
2026-07-15 21:52:01 01559_aggregate_null_for_empty_fix: [ OK ] 1.70 sec.
2026-07-15 21:52:02 02661_quantile_approx: [ OK ] 2.92 sec.
2026-07-15 21:52:02 02015_async_inserts_1: [ OK ] 5.53 sec.
2026-07-15 21:52:02 02703_max_local_read_bandwidth: [ OK ] 34.54 sec.
2026-07-15 21:52:02 02479_mysql_connect_to_self: [ OK ] 3.27 sec.
2026-07-15 21:52:03 03131_deprecated_functions: [ OK ] 1.35 sec.
2026-07-15 21:52:03 02908_filesystem_cache_as_collection: [ OK ] 1.05 sec.
2026-07-15 21:52:03 02707_analyzer_nested_lambdas_types: [ OK ] 0.94 sec.
2026-07-15 21:52:04 02129_add_column_add_ttl: [ OK ] 2.32 sec.
2026-07-15 21:52:04 00626_replace_partition_from_table_zookeeper: [ OK ] 95.74 sec.
2026-07-15 21:52:05 02920_rename_column_of_skip_indices: [ OK ] 1.35 sec.
2026-07-15 21:52:05 01187_set_profile_as_setting: [ OK ] 4.13 sec.
2026-07-15 21:52:05 02900_matview_create_to_errors: [ OK ] 2.66 sec.
2026-07-15 21:52:05 02998_analyzer_secret_args_tree_node: [ OK ] 0.96 sec.
2026-07-15 21:52:06 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.94 sec.
2026-07-15 21:52:06 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 1.35 sec.
2026-07-15 21:52:07 02833_sparse_columns_tuple_function: [ OK ] 1.09 sec.
2026-07-15 21:52:07 01272_totals_and_filter_bug: [ OK ] 1.35 sec.
2026-07-15 21:52:07 01655_test_isnull_mysql_dialect: [ OK ] 0.84 sec.
2026-07-15 21:52:08 00758_array_reverse: [ OK ] 1.50 sec.
2026-07-15 21:52:10 01073_crlf_end_of_line: [ OK ] 1.36 sec.
2026-07-15 21:52:10 02455_default_union_except_intersect: [ OK ] 2.78 sec.
2026-07-15 21:52:11 00055_join_two_numbers: [ OK ] 0.91 sec.
2026-07-15 21:52:12 02244_ip_address_invalid_insert: [ OK ] 2.52 sec.
2026-07-15 21:52:12 01832_memory_write_suffix: [ OK ] 1.12 sec.
2026-07-15 21:52:13 02480_client_option_print_num_processed_rows: [ OK ] 6.90 sec.
2026-07-15 21:52:13 03129_cte_with_final: [ OK ] 1.12 sec.
2026-07-15 21:52:15 03130_convert_outer_join_to_inner_join: [ OK ] 2.11 sec.
2026-07-15 21:52:16 01458_count_digits: [ OK ] 1.36 sec.
2026-07-15 21:52:17 03156_analyzer_array_join_distributed: [ OK ] 3.08 sec.
2026-07-15 21:52:18 02845_arrayShiftRotate: [ OK ] 4.64 sec.
2026-07-15 21:52:18 02014_map_different_keys: [ OK ] 1.73 sec.
2026-07-15 21:52:18 00472_create_view_if_not_exists: [ OK ] 1.18 sec.
2026-07-15 21:52:18 01504_rocksdb: [ OK ] 14.25 sec.
2026-07-15 21:52:19 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 1.05 sec.
2026-07-15 21:52:20 01513_defaults_on_defaults_no_column: [ OK ] 1.55 sec.
2026-07-15 21:52:21 02032_short_circuit_least_greatest_bug: [ OK ] 0.84 sec.
2026-07-15 21:52:22 02026_accurate_cast_or_default: [ OK ] 3.12 sec.
2026-07-15 21:52:22 02428_combinators_with_over_statement: [ OK ] 1.15 sec.
2026-07-15 21:52:23 02981_vertical_merges_memory_usage: [ OK ] 15.98 sec.
2026-07-15 21:52:23 01787_arena_assert_column_nothing: [ OK ] 0.86 sec.
2026-07-15 21:52:25 01050_engine_join_view_crash: [ OK ] 1.51 sec.
2026-07-15 21:52:26 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.85 sec.
2026-07-15 21:52:26 02366_kql_func_dynamic: [ OK ] 8.51 sec.
2026-07-15 21:52:27 02967_analyzer_fuzz: [ OK ] 1.35 sec.
2026-07-15 21:52:28 02317_functions_with_nothing: [ OK ] 1.10 sec.
2026-07-15 21:52:28 02344_describe_cache: [ OK ] 4.68 sec.
2026-07-15 21:52:28 03041_dynamic_type_check_table: [ OK ] 25.00 sec.
2026-07-15 21:52:29 01293_show_settings: [ OK ] 0.66 sec.
2026-07-15 21:52:29 01522_validate_alter_default: [ OK ] 1.21 sec.
2026-07-15 21:52:30 00177_inserts_through_http_parts: [ OK ] 2.78 sec.
2026-07-15 21:52:30 02366_kql_summarize: [ OK ] 7.84 sec.
2026-07-15 21:52:30 02991_count_rewrite_analyzer: [ OK ] 1.26 sec.
2026-07-15 21:52:32 02809_has_subsequence: [ OK ] 4.30 sec.
2026-07-15 21:52:32 01106_const_fixed_string_like: [ OK ] 3.07 sec.
2026-07-15 21:52:32 02366_kql_mvexpand: [ OK ] 2.30 sec.
2026-07-15 21:52:34 03003_prql_panic: [ OK ] 3.21 sec.
2026-07-15 21:52:34 01098_sum: [ OK ] 1.82 sec.
2026-07-15 21:52:35 01425_decimal_parse_big_negative_exponent: [ OK ] 1.56 sec.
2026-07-15 21:52:38 03215_parsing_archive_name_s3: [ OK ] 3.59 sec.
2026-07-15 21:52:38 00265_http_content_type_format_timezone: [ OK ] 5.50 sec.
2026-07-15 21:52:38 02883_read_in_reverse_order_virtual_column: [ OK ] 5.34 sec.
2026-07-15 21:52:38 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 2.48 sec.
2026-07-15 21:52:39 02021_h3_is_res_classIII: [ OK ] 1.05 sec.
2026-07-15 21:52:39 00552_logical_functions_uint8_as_bool: [ OK ] 0.86 sec.
2026-07-15 21:52:39 03038_nested_dynamic_merges_wide_horizontal: [ SKIPPED ] 0.00 sec.
2026-07-15 21:52:39 Reason: not running for current build
2026-07-15 21:52:39 01513_optimize_aggregation_in_order_memory_long: [ OK ] 37.44 sec.
2026-07-15 21:52:39 02246_flatten_tuple: [ OK ] 1.46 sec.
2026-07-15 21:52:40 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.86 sec.
2026-07-15 21:52:40 01410_nullable_key_and_index_negate_cond: [ OK ] 2.06 sec.
2026-07-15 21:52:40 02370_analyzer_in_function: [ OK ] 1.57 sec.
2026-07-15 21:52:40 01017_uniqCombined_memory_usage: [ SKIPPED ] 0.00 sec.
2026-07-15 21:52:40 Reason: not running for current build
2026-07-15 21:52:41 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 1.80 sec.
2026-07-15 21:52:42 01634_sum_map_nulls: [ OK ] 1.16 sec.
2026-07-15 21:52:43 01051_aggregate_function_crash: [ OK ] 0.91 sec.
2026-07-15 21:52:45 00900_null_array_orc_load: [ OK ] 5.93 sec.
2026-07-15 21:52:45 00900_orc_arrow_parquet_maps: [ OK ] 15.41 sec.
2026-07-15 21:52:46 01289_min_execution_speed_not_too_early: [ OK ] 5.99 sec.
2026-07-15 21:52:46 01700_mod_negative_type_promotion: [ OK ] 1.10 sec.
2026-07-15 21:52:47 01795_TinyLog_rwlock_ub: [ OK ] 1.06 sec.
2026-07-15 21:52:47 00535_parse_float_scientific: [ OK ] 0.94 sec.
2026-07-15 21:52:48 01917_prewhere_column_type: [ OK ] 1.43 sec.
2026-07-15 21:52:48 01680_date_time_add_ubsan: [ OK ] 1.55 sec.
2026-07-15 21:52:50 02845_domain_rfc_support_ipv6: [ OK ] 1.81 sec.
2026-07-15 21:52:51 01287_max_execution_speed: [ OK ] 7.10 sec.
2026-07-15 21:52:51 01330_array_join_in_higher_order_function: [ OK ] 0.85 sec.
2026-07-15 21:52:52 02301_harmful_reexec: [ OK ] 3.45 sec.
2026-07-15 21:52:52 03203_client_benchmark_options: [ OK ] 11.81 sec.
2026-07-15 21:52:53 02242_case_insensitive_column_matching: [ OK ] 13.41 sec.
2026-07-15 21:52:54 00104_totals_having_mode: [ OK ] 2.21 sec.
2026-07-15 21:52:55 02030_function_mapContainsKeyLike: [ OK ] 1.61 sec.
2026-07-15 21:52:55 00346_if_tuple: [ OK ] 1.04 sec.
2026-07-15 21:52:57 00556_array_intersect: [ OK ] 1.61 sec.
2026-07-15 21:52:57 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 1.94 sec.
2026-07-15 21:52:58 03093_with_fill_support_constant_expression: [ OK ] 0.87 sec.
2026-07-15 21:52:58 00825_protobuf_format_skipped_column_in_nested: [ OK ] 6.13 sec.
2026-07-15 21:52:59 02176_toStartOfWeek_overflow_pruning: [ OK ] 1.34 sec.
2026-07-15 21:53:00 02676_kafka_murmur_hash: [ OK ] 0.99 sec.
2026-07-15 21:53:00 02267_jsonlines_ndjson_format: [ OK ] 1.09 sec.
2026-07-15 21:53:00 02884_parquet_new_encodings: [ OK ] 2.71 sec.
2026-07-15 21:53:02 02734_optimize_group_by: [ OK ] 1.95 sec.
2026-07-15 21:53:04 02295_GROUP_BY_AggregateFunction: [ OK ] 3.87 sec.
2026-07-15 21:53:04 02224_parallel_distributed_insert_select_cluster: [ OK ] 3.19 sec.
2026-07-15 21:53:06 01032_cityHash64_for_UUID: [ OK ] 1.92 sec.
2026-07-15 21:53:06 02834_formats_with_variable_number_of_columns: [ OK ] 2.01 sec.
2026-07-15 21:53:06 02233_HTTP_ranged: [ OK ] 3.64 sec.
2026-07-15 21:53:07 02232_partition_pruner_mixed_constant_type: [ OK ] 1.20 sec.
2026-07-15 21:53:08 00570_empty_array_is_const: [ OK ] 1.06 sec.
2026-07-15 21:53:09 02426_orc_bug: [ OK ] 3.16 sec.
2026-07-15 21:53:09 01666_merge_tree_max_query_limit: [ OK ] 17.68 sec.
2026-07-15 21:53:10 03057_analyzer_subquery_alias_join: [ OK ] 1.00 sec.
2026-07-15 21:53:10 02421_simple_queries_for_opentelemetry: [ OK ] 23.57 sec.
2026-07-15 21:53:11 02160_h3_cell_area_m2: [ OK ] 1.65 sec.
2026-07-15 21:53:11 03003_analyzer_setting: [ OK ] 0.92 sec.
2026-07-15 21:53:11 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 3.33 sec.
2026-07-15 21:53:12 02184_ipv6_cast_test: [ OK ] 0.95 sec.
2026-07-15 21:53:12 00901_joint_entropy: [ OK ] 1.01 sec.
2026-07-15 21:53:14 00338_replicate_array_of_strings: [ OK ] 1.30 sec.
2026-07-15 21:53:14 02710_protobuf_ipv4_date32: [ OK ] 4.09 sec.
2026-07-15 21:53:15 02592_avro_records_with_same_names: [ OK ] 2.87 sec.
2026-07-15 21:53:16 01731_async_task_queue_wait: [ OK ] 4.32 sec.
2026-07-15 21:53:16 01088_array_slice_of_aggregate_functions: [ OK ] 0.90 sec.
2026-07-15 21:53:17 00679_uuid_in_key: [ OK ] 1.34 sec.
2026-07-15 21:53:21 00688_low_cardinality_dictionary_deserialization: [ OK ] 7.51 sec.
2026-07-15 21:53:26 01894_jit_aggregation_function_max_long: [ OK ] 8.45 sec.
2026-07-15 21:53:27 01801_s3_cluster_count: [ OK ] 1.36 sec.
2026-07-15 21:53:27 02731_parallel_replicas_join_subquery: [ OK ] 10.77 sec.
2026-07-15 21:53:28 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 13.74 sec.
2026-07-15 21:53:28 02493_inconsistent_hex_and_binary_number: [ OK ] 6.78 sec.
2026-07-15 21:53:29 02412_nlp: [ OK ] 1.20 sec.
2026-07-15 21:53:31 02592_avro_more_types: [ OK ] 3.37 sec.
2026-07-15 21:53:31 01356_state_resample: [ OK ] 1.32 sec.
2026-07-15 21:53:31 02784_parallel_replicas_automatic_decision: [ OK ] 41.05 sec.
2026-07-15 21:53:32 02990_optimize_uniq_to_count_alias: [ OK ] 1.09 sec.
2026-07-15 21:53:32 02454_compressed_marks_in_compact_part: [ OK ] 1.10 sec.
2026-07-15 21:53:32 00550_join_insert_select: [ OK ] 3.93 sec.
2026-07-15 21:53:33 00558_aggregate_merge_totals_with_arenas: [ OK ] 1.00 sec.
2026-07-15 21:53:33 02968_mysql_prefer_column_name_to_alias: [ OK ] 2.30 sec.
2026-07-15 21:53:33 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.83 sec.
2026-07-15 21:53:33 02024_create_dictionary_with_comment: [ OK ] 0.86 sec.
2026-07-15 21:53:34 02426_pod_array_overflow_2: [ OK ] 0.80 sec.
2026-07-15 21:53:34 03207_json_read_subcolumns_1_memory: [ OK ] 6.65 sec.
2026-07-15 21:53:34 02699_polygons_sym_difference_rollup: [ OK ] 1.04 sec.
2026-07-15 21:53:34 00263_merge_aggregates_and_overflow: [ OK ] 0.99 sec.
2026-07-15 21:53:35 02988_ordinary_database_warning: [ OK ] 0.79 sec.
2026-07-15 21:53:35 01582_distinct_subquery_groupby: [ OK ] 1.15 sec.
2026-07-15 21:53:36 02898_parallel_replicas_custom_key_final: [ OK ] 1.34 sec.
2026-07-15 21:53:36 03165_distinct_with_window_func_crash: [ OK ] 1.11 sec.
2026-07-15 21:53:37 02355_control_block_size_in_array_join: [ OK ] 1.64 sec.
2026-07-15 21:53:37 03100_analyzer_constants_in_multiif: [ OK ] 0.95 sec.
2026-07-15 21:53:37 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 3.76 sec.
2026-07-15 21:53:37 01383_log_broken_table: [ OK ] 79.26 sec.
2026-07-15 21:53:37 03006_join_on_inequal_expression_3: [ OK ] 3.51 sec.
2026-07-15 21:53:37 01358_mutation_delete_null_rows: [ OK ] 1.62 sec.
2026-07-15 21:53:37 03168_fuzz_multiIf_short_circuit: [ OK ] 0.80 sec.
2026-07-15 21:53:38 00098_g_union_all: [ OK ] 0.74 sec.
2026-07-15 21:53:38 01416_clear_column_pk: [ OK ] 1.16 sec.
2026-07-15 21:53:39 03145_asof_join_ddb_inequalities: [ OK ] 1.64 sec.
2026-07-15 21:53:39 02974_analyzer_array_join_subcolumn: [ OK ] 1.49 sec.
2026-07-15 21:53:39 03169_modify_column_data_loss: [ OK ] 1.25 sec.
2026-07-15 21:53:40 00353_join_by_tuple: [ OK ] 0.74 sec.
2026-07-15 21:53:40 02875_parallel_replicas_remote: [ OK ] 3.03 sec.
2026-07-15 21:53:40 02382_join_and_filtering_set: [ OK ] 1.89 sec.
2026-07-15 21:53:41 02579_fill_empty_chunk_analyzer: [ OK ] 0.79 sec.
2026-07-15 21:53:41 01307_polygon_perimeter: [ OK ] 0.79 sec.
2026-07-15 21:53:41 02167_format_from_file_extension: [ OK ] 35.03 sec.
2026-07-15 21:53:41 01278_format_multiple_queries: [ OK ] 2.15 sec.
2026-07-15 21:53:42 02597_projection_materialize_and_replication: [ OK ] 2.75 sec.
2026-07-15 21:53:42 00459_group_array_insert_at: [ OK ] 1.20 sec.
2026-07-15 21:53:42 01837_cast_to_array_from_empty_array: [ OK ] 0.79 sec.
2026-07-15 21:53:43 02481_i43247_ubsan_in_minmaxany: [ OK ] 1.15 sec.
2026-07-15 21:53:43 00578_merge_table_and_table_virtual_column: [ OK ] 2.10 sec.
2026-07-15 21:53:44 00738_lock_for_inner_table: [ OK ] 6.78 sec.
2026-07-15 21:53:44 02798_explain_settings_not_applied_bug: [ OK ] 1.16 sec.
2026-07-15 21:53:44 02267_join_dup_columns_issue36199: [ OK ] 2.65 sec.
2026-07-15 21:53:45 01035_prewhere_with_alias: [ OK ] 1.04 sec.
2026-07-15 21:53:45 01323_if_with_nulls: [ OK ] 2.01 sec.
2026-07-15 21:53:45 03002_analyzer_prewhere: [ OK ] 1.39 sec.
2026-07-15 21:53:46 01710_query_log_with_projection_info: [ OK ] 3.56 sec.
2026-07-15 21:53:46 02995_bad_formatting_union_intersect: [ OK ] 0.84 sec.
2026-07-15 21:53:46 01669_test_toYear_mysql_dialect: [ OK ] 0.70 sec.
2026-07-15 21:53:46 02473_multistep_split_prewhere: [ OK ] 106.73 sec.
2026-07-15 21:53:47 00209_insert_select_extremes: [ OK ] 1.21 sec.
2026-07-15 21:53:47 00232_format_readable_decimal_size: [ OK ] 0.85 sec.
2026-07-15 21:53:48 02886_missed_json_subcolumns: [ OK ] 1.84 sec.
2026-07-15 21:53:48 02785_global_join_too_many_columns: [ OK ] 1.14 sec.
2026-07-15 21:53:48 03160_dynamic_type_agg: [ OK ] 0.84 sec.
2026-07-15 21:53:48 02995_index_6: [ SKIPPED ] 0.00 sec.
2026-07-15 21:53:48 Reason: not running for current build
2026-07-15 21:53:48 01214_test_storage_merge_aliases_with_where: [ OK ] 1.85 sec.
2026-07-15 21:53:49 01081_window_view_target_table_engine: [ OK ] 6.82 sec.
2026-07-15 21:53:49 03149_variant_pop_back_typo: [ OK ] 0.86 sec.
2026-07-15 21:53:49 00014_select_from_table_with_nested: [ OK ] 1.30 sec.
2026-07-15 21:53:50 02902_select_subcolumns_from_engine_null: [ OK ] 0.86 sec.
2026-07-15 21:53:51 01256_misspell_layout_name_podshumok: [ OK ] 0.79 sec.
2026-07-15 21:53:52 02113_format_row: [ OK ] 0.90 sec.
2026-07-15 21:53:54 01881_join_on_conditions_hash: [ OK ] 9.64 sec.
2026-07-15 21:53:54 02984_form_format: [ OK ] 5.58 sec.
2026-07-15 21:53:55 02366_kql_func_ip: [ OK ] 8.95 sec.
2026-07-15 21:53:56 02381_compress_marks_and_primary_key: [ OK ] 8.15 sec.
2026-07-15 21:53:56 01746_forbid_drop_column_referenced_by_mv: [ OK ] 2.56 sec.
2026-07-15 21:53:57 02539_settings_alias: [ OK ] 9.20 sec.
2026-07-15 21:53:57 01384_bloom_filter_bad_arguments: [ OK ] 1.29 sec.
2026-07-15 21:53:57 01498_alter_column_storage_memory: [ OK ] 0.84 sec.
2026-07-15 21:53:57 00942_mv_rename_table: [ OK ] 1.04 sec.
2026-07-15 21:53:58 00024_unused_array_join_in_subquery: [ OK ] 0.74 sec.
2026-07-15 21:53:58 00617_array_in: [ OK ] 1.09 sec.
2026-07-15 21:53:59 01070_alter_with_ttl: [ OK ] 1.15 sec.
2026-07-15 21:53:59 02884_duplicate_index_name: [ OK ] 0.80 sec.
2026-07-15 21:53:59 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 1.75 sec.
2026-07-15 21:54:00 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.81 sec.
2026-07-15 21:54:01 02454_create_table_with_custom_disk: [ OK ] 1.41 sec.
2026-07-15 21:54:01 02769_compare_functions_nan: [ OK ] 2.78 sec.
2026-07-15 21:54:02 02969_analyzer_eliminate_injective_functions: [ OK ] 1.15 sec.
2026-07-15 21:54:03 01499_log_deadlock: [ OK ] 1.42 sec.
2026-07-15 21:54:03 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.95 sec.
2026-07-15 21:54:04 03303_alias_inverse_order: [ OK ] 1.00 sec.
2026-07-15 21:54:05 01213_alter_table_rename_nested: [ OK ] 1.76 sec.
2026-07-15 21:54:05 02915_analyzer_fuzz_2: [ OK ] 1.02 sec.
2026-07-15 21:54:06 02366_explain_query_tree: [ OK ] 1.51 sec.
2026-07-15 21:54:07 01825_type_json_from_map: [ OK ] 12.42 sec.
2026-07-15 21:54:08 03006_buffer_overflow_join: [ OK ] 1.51 sec.
2026-07-15 21:54:09 01069_insert_float_as_nullable_unit8: [ OK ] 1.01 sec.
2026-07-15 21:54:11 01018_Distributed__shard_num: [ OK ] 4.99 sec.
2026-07-15 21:54:12 03215_varian_as_common_type_tuple_map: [ OK ] 0.96 sec.
2026-07-15 21:54:12 02884_string_distance_function: [ OK ] 2.83 sec.
2026-07-15 21:54:13 00709_virtual_column_partition_id: [ OK ] 1.12 sec.
2026-07-15 21:54:13 01652_ttl_old_syntax: [ OK ] 1.19 sec.
2026-07-15 21:54:14 02122_parallel_formatting_Pretty: [ OK ] 14.05 sec.
2026-07-15 21:54:16 00986_materialized_view_stack_overflow: [ OK ] 2.46 sec.
2026-07-15 21:54:19 02915_lazy_loading_of_base_backups: [ OK ] 12.44 sec.
2026-07-15 21:54:20 02802_clickhouse_disks_s3_copy: [ OK ] 5.45 sec.
2026-07-15 21:54:21 00981_no_virtual_columns: [ OK ] 1.30 sec.
2026-07-15 21:54:22 00183_skip_unavailable_shards: [ OK ] 24.97 sec.
2026-07-15 21:54:26 02876_yyyymmddtodate: [ OK ] 5.21 sec.
2026-07-15 21:54:26 02423_ddl_for_opentelemetry: [ OK ] 45.56 sec.
2026-07-15 21:54:27 03036_reading_s3_archives: [ OK ] 4.63 sec.
2026-07-15 21:54:27 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.94 sec.
2026-07-15 21:54:28 02233_with_total_empty_chunk: [ OK ] 0.74 sec.
2026-07-15 21:54:28 00712_prewhere_with_alias_bug_2: [ OK ] 1.00 sec.
2026-07-15 21:54:28 01768_extended_range: [ OK ] 0.90 sec.
2026-07-15 21:54:29 03165_parseReadableSize: [ OK ] 3.12 sec.
2026-07-15 21:54:30 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.96 sec.
2026-07-15 21:54:31 02910_bad_logs_level_in_local: [ OK ] 0.90 sec.
2026-07-15 21:54:33 01600_quota_by_forwarded_ip: [ OK ] 4.64 sec.
2026-07-15 21:54:33 01882_check_max_parts_to_merge_at_once: [ OK ] 17.12 sec.
2026-07-15 21:54:33 01950_kill_large_group_by_query: [ OK ] 4.98 sec.
2026-07-15 21:54:34 00164_not_chain: [ OK ] 1.06 sec.
2026-07-15 21:54:35 01272_offset_without_limit: [ OK ] 1.05 sec.
2026-07-15 21:54:35 02791_final_block_structure_mismatch_bug: [ OK ] 3.43 sec.
2026-07-15 21:54:35 01710_projection_with_ast_rewrite_settings: [ OK ] 1.91 sec.
2026-07-15 21:54:36 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.95 sec.
2026-07-15 21:54:36 02995_index_10: [ SKIPPED ] 0.00 sec.
2026-07-15 21:54:36 Reason: not running for current build
2026-07-15 21:54:36 02286_convert_decimal_type: [ OK ] 0.90 sec.
2026-07-15 21:54:36 02874_toDaysSinceYearZero: [ OK ] 2.02 sec.
2026-07-15 21:54:37 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.95 sec.
2026-07-15 21:54:37 01710_projection_array_join: [ OK ] 0.91 sec.
2026-07-15 21:54:37 02579_parameterized_replace: [ OK ] 0.99 sec.
2026-07-15 21:54:39 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 1.70 sec.
2026-07-15 21:54:40 00625_arrays_in_nested: [ OK ] 2.25 sec.
2026-07-15 21:54:40 02158_ztest: [ OK ] 1.05 sec.
2026-07-15 21:54:41 02861_filter_pushdown_const_bug: [ OK ] 1.81 sec.
2026-07-15 21:54:42 02344_distinct_limit_distiributed: [ OK ] 4.37 sec.
2026-07-15 21:54:42 02874_json_merge_patch_function_test: [ OK ] 1.80 sec.
2026-07-15 21:54:43 01525_select_with_offset_fetch_clause: [ OK ] 1.16 sec.
2026-07-15 21:54:43 01490_nullable_string_to_enum: [ OK ] 1.04 sec.
2026-07-15 21:54:44 00876_wrong_arraj_join_column: [ OK ] 1.00 sec.
2026-07-15 21:54:44 03066_analyzer_global_with_statement: [ OK ] 0.85 sec.
2026-07-15 21:54:45 00387_use_client_time_zone: [ OK ] 2.87 sec.
2026-07-15 21:54:47 02998_http_redirects: [ OK ] 2.27 sec.
2026-07-15 21:54:48 00653_verification_monotonic_data_load: [ OK ] 34.77 sec.
2026-07-15 21:54:49 02532_send_logs_level_test: [ OK ] 4.78 sec.
2026-07-15 21:54:49 02582_async_reading_with_small_limit: [ OK ] 1.15 sec.
2026-07-15 21:54:50 00975_json_hang: [ OK ] 2.37 sec.
2026-07-15 21:54:50 03036_dynamic_read_shared_subcolumns_memory: [ SKIPPED ] 0.00 sec.
2026-07-15 21:54:50 Reason: not running for current build
2026-07-15 21:54:50 02271_temporary_table_show_rows_bytes: [ OK ] 0.90 sec.
2026-07-15 21:54:51 02999_ulid_short_circuit: [ OK ] 0.80 sec.
2026-07-15 21:54:51 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 1.30 sec.
2026-07-15 21:54:51 00872_t64_bit_codec: [ OK ] 7.28 sec.
2026-07-15 21:54:52 02918_optimize_count_for_merge_tables: [ OK ] 1.45 sec.
2026-07-15 21:54:52 00476_pretty_formats_and_widths: [ OK ] 1.10 sec.
2026-07-15 21:54:52 01076_predicate_optimizer_with_view: [ OK ] 1.30 sec.
2026-07-15 21:54:53 01497_extract_all_groups_empty_match: [ OK ] 0.80 sec.
2026-07-15 21:54:53 02771_if_constant_folding: [ OK ] 0.98 sec.
2026-07-15 21:54:53 01416_join_totals_header_bug: [ OK ] 1.25 sec.
2026-07-15 21:54:55 01274_alter_rename_column_distributed: [ OK ] 1.30 sec.
2026-07-15 21:54:55 02436_system_zookeeper_context: [ OK ] 1.25 sec.
2026-07-15 21:54:56 02353_compression_level: [ OK ] 21.15 sec.
2026-07-15 21:54:56 00538_datediff: [ OK ] 3.02 sec.
2026-07-15 21:54:57 00405_output_format_pretty_color: [ OK ] 2.28 sec.
2026-07-15 21:54:57 00841_temporary_table_database: [ OK ] 1.01 sec.
2026-07-15 21:54:58 02457_filesystem_function: [ OK ] 0.97 sec.
2026-07-15 21:54:58 01062_pm_all_join_with_block_continuation: [ OK ] 66.32 sec.
2026-07-15 21:54:59 02999_variant_suspicious_types: [ OK ] 0.90 sec.
2026-07-15 21:55:00 01084_defaults_on_aliases: [ OK ] 1.66 sec.
2026-07-15 21:55:01 02417_null_variadic_behaviour: [ OK ] 3.21 sec.
2026-07-15 21:55:02 02016_summing_mt_aggregating_column: [ OK ] 1.36 sec.
2026-07-15 21:55:02 01276_random_string: [ OK ] 5.83 sec.
2026-07-15 21:55:03 01632_max_partitions_to_read: [ OK ] 1.63 sec.
2026-07-15 21:55:04 02306_rowbinary_has_no_bom: [ OK ] 2.46 sec.
2026-07-15 21:55:09 01811_storage_buffer_flush_parameters: [ OK ] 7.36 sec.
2026-07-15 21:55:10 02025_having_filter_column: [ OK ] 0.94 sec.
2026-07-15 21:55:10 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 11.86 sec.
2026-07-15 21:55:11 00974_full_outer_join: [ OK ] 1.01 sec.
2026-07-15 21:55:11 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.90 sec.
2026-07-15 21:55:13 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 9.56 sec.
2026-07-15 21:55:15 01910_view_dictionary_check_refresh: [ OK ] 26.18 sec.
2026-07-15 21:55:15 02343_group_by_use_nulls: [ OK ] 2.30 sec.
2026-07-15 21:55:16 00355_array_of_non_const_convertible_types: [ OK ] 0.80 sec.
2026-07-15 21:55:18 02789_reading_from_s3_with_connection_pool: [ OK ] 22.52 sec.
2026-07-15 21:55:19 01710_minmax_count_projection_distributed_query: [ OK ] 1.04 sec.
2026-07-15 21:55:19 01244_optimize_distributed_group_by_sharding_key: [ OK ] 8.40 sec.
2026-07-15 21:55:20 02122_parallel_formatting_JSONCompact: [ OK ] 8.15 sec.
2026-07-15 21:55:20 01518_filtering_aliased_materialized_column: [ OK ] 0.89 sec.
2026-07-15 21:55:20 03033_cte_numbers_memory: [ OK ] 0.81 sec.
2026-07-15 21:55:21 01284_escape_sequences_php_mysql_style: [ OK ] 1.04 sec.
2026-07-15 21:55:22 00857_global_joinsavel_table_alias: [ OK ] 2.55 sec.
2026-07-15 21:55:23 00829_bitmap_function: [ OK ] 7.09 sec.
2026-07-15 21:55:23 00482_subqueries_and_aliases: [ OK ] 1.00 sec.
2026-07-15 21:55:24 00268_aliases_without_as_keyword: [ OK ] 0.81 sec.
2026-07-15 21:55:24 00082_append_trailing_char_if_absent: [ OK ] 0.89 sec.
2026-07-15 21:55:26 02584_compressor_codecs: [ OK ] 4.54 sec.
2026-07-15 21:55:29 01651_lc_insert_tiny_log_2: [ OK ] 13.46 sec.
2026-07-15 21:55:29 03212_thousand_exceptions: [ OK ] 69.39 sec.
2026-07-15 21:55:29 00717_merge_and_distributed: [ OK ] 4.56 sec.
2026-07-15 21:55:30 03038_ambiguous_column: [ OK ] 1.04 sec.
2026-07-15 21:55:30 01085_simdjson_uint64: [ OK ] 0.74 sec.
2026-07-15 21:55:31 01559_misplaced_codec_diagnostics: [ OK ] 0.74 sec.
2026-07-15 21:55:31 02561_sorting_constants_and_distinct_crash: [ OK ] 7.03 sec.
2026-07-15 21:55:32 02975_intdiv_with_decimal: [ OK ] 2.75 sec.
2026-07-15 21:55:32 02815_fix_not_found_constants_col_in_block: [ OK ] 0.94 sec.
2026-07-15 21:55:33 02864_restore_table_with_broken_part: [ OK ] 6.47 sec.
2026-07-15 21:55:33 01514_empty_buffer_different_types: [ OK ] 1.20 sec.
2026-07-15 21:55:33 02687_native_fuzz: [ OK ] 0.79 sec.
2026-07-15 21:55:34 02871_join_on_system_errors: [ OK ] 0.84 sec.
2026-07-15 21:55:36 02013_zlib_read_after_eof: [ OK ] 6.02 sec.
2026-07-15 21:55:37 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.90 sec.
2026-07-15 21:55:37 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec.
2026-07-15 21:55:37 Reason: not running for current build
2026-07-15 21:55:38 02306_window_move_row_number_fix: [ OK ] 0.79 sec.
2026-07-15 21:55:39 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 1.22 sec.
2026-07-15 21:55:39 02841_parallel_final_wrong_columns_order: [ OK ] 4.92 sec.
2026-07-15 21:55:39 02149_schema_inference_formats_with_schema_3: [ OK ] 8.68 sec.
2026-07-15 21:55:40 01514_parallel_formatting: [ OK ] 7.12 sec.
2026-07-15 21:55:40 02012_zookeeper_changed_enum_type: [ OK ] 1.19 sec.
2026-07-15 21:55:40 02953_slow_create_view: [ OK ] 0.99 sec.
2026-07-15 21:55:41 02870_per_column_settings: [ OK ] 1.84 sec.
2026-07-15 21:55:41 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 1.19 sec.
2026-07-15 21:55:41 00680_duplicate_columns_inside_union_all: [ OK ] 0.94 sec.
2026-07-15 21:55:42 00974_primary_key_for_lowCardinality: [ OK ] 8.72 sec.
2026-07-15 21:55:42 03151_pmj_join_non_procssed_clash: [ OK ] 0.89 sec.
2026-07-15 21:55:42 02910_object-json-crash-add-column: [ OK ] 1.49 sec.
2026-07-15 21:55:43 01414_freeze_does_not_prevent_alters: [ OK ] 1.70 sec.
2026-07-15 21:55:43 00503_cast_const_nullable: [ OK ] 0.84 sec.
2026-07-15 21:55:43 03039_dynamic_summing_merge_tree: [ OK ] 39.28 sec.
2026-07-15 21:55:44 00688_low_cardinality_alter_add_column: [ OK ] 0.94 sec.
2026-07-15 21:55:44 01083_aggregation_memory_efficient_bug: [ OK ] 1.90 sec.
2026-07-15 21:55:44 03155_datasketches_ubsan: [ OK ] 0.80 sec.
2026-07-15 21:55:45 00746_hashing_tuples: [ OK ] 1.50 sec.
2026-07-15 21:55:45 02989_variant_comparison: [ OK ] 2.38 sec.
2026-07-15 21:55:45 02160_client_autocomplete_parse_query: [ OK ] 4.01 sec.
2026-07-15 21:55:46 03166_optimize_row_order_during_insert: [ OK ] 1.55 sec.
2026-07-15 21:55:46 02029_quantile_sanitizer: [ OK ] 0.74 sec.
2026-07-15 21:55:46 01442_date_time_with_params: [ OK ] 4.31 sec.
2026-07-15 21:55:47 02481_xxh3_hash_function: [ OK ] 0.70 sec.
2026-07-15 21:55:48 00045_sorting_by_fixed_string_descending: [ OK ] 0.69 sec.
2026-07-15 21:55:49 01448_json_compact_strings_each_row: [ OK ] 3.16 sec.
2026-07-15 21:55:49 00341_squashing_insert_select2: [ OK ] 1.74 sec.
2026-07-15 21:55:51 00951_ngram_search: [ OK ] 7.72 sec.
2026-07-15 21:55:51 00820_multiple_joins_subquery_requires_alias: [ OK ] 1.85 sec.
2026-07-15 21:55:52 02477_exists_fuzz_43478: [ OK ] 0.89 sec.
2026-07-15 21:55:52 01255_geo_types_livace: [ OK ] 0.94 sec.
2026-07-15 21:55:53 02374_analyzer_join_using: [ OK ] 7.93 sec.
2026-07-15 21:55:53 00917_multiple_joins_denny_crane: [ OK ] 1.14 sec.
2026-07-15 21:55:54 01308_row_policy_and_trivial_count_query: [ OK ] 0.99 sec.
2026-07-15 21:55:55 01866_view_persist_settings: [ OK ] 2.86 sec.
2026-07-15 21:55:56 01518_nullable_aggregate_states2: [ OK ] 9.83 sec.
2026-07-15 21:55:56 01651_map_functions: [ OK ] 2.89 sec.
2026-07-15 21:55:57 02477_age: [ OK ] 2.55 sec.
2026-07-15 21:55:57 02375_scalar_lc_cte: [ OK ] 0.69 sec.
2026-07-15 21:55:58 01259_dictionary_custom_settings_ddl: [ OK ] 1.09 sec.
2026-07-15 21:55:58 01515_logtrace_function: [ OK ] 2.54 sec.
2026-07-15 21:55:58 01104_distributed_one_test: [ OK ] 1.69 sec.
2026-07-15 21:55:59 01640_distributed_async_insert_compression: [ OK ] 1.25 sec.
2026-07-15 21:56:00 01710_normal_projection_join_plan_fix: [ OK ] 1.51 sec.
2026-07-15 21:56:01 01070_string_to_h3: [ OK ] 0.96 sec.
2026-07-15 21:56:02 02332_dist_insert_send_logs_level: [ OK ] 4.38 sec.
2026-07-15 21:56:02 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 1.02 sec.
2026-07-15 21:56:04 00386_long_in_pk: [ OK ] 44.43 sec.
2026-07-15 21:56:05 00700_decimal_casts: [ OK ] 7.74 sec.
2026-07-15 21:56:05 00239_type_conversion_in_in: [ OK ] 1.05 sec.
2026-07-15 21:56:06 00999_join_not_nullable_types: [ OK ] 1.05 sec.
2026-07-15 21:56:07 02886_binary_like: [ OK ] 1.62 sec.
2026-07-15 21:56:07 01016_macros: [ OK ] 0.90 sec.
2026-07-15 21:56:08 01925_date_date_time_comparison: [ OK ] 0.90 sec.
2026-07-15 21:56:09 00439_fixed_string_filter: [ OK ] 0.93 sec.
2026-07-15 21:56:11 01892_setting_limit_offset_distributed: [ OK ] 1.76 sec.
2026-07-15 21:56:11 01083_window_view_select: [ OK ] 8.97 sec.
2026-07-15 21:56:11 02995_index_5: [ SKIPPED ] 0.00 sec.
2026-07-15 21:56:11 Reason: not running for current build
2026-07-15 21:56:11 02324_compatibility_setting: [ OK ] 9.24 sec.
2026-07-15 21:56:12 02560_quantile_min_max: [ OK ] 1.01 sec.
2026-07-15 21:56:13 00842_array_with_constant_overflow: [ OK ] 0.89 sec.
2026-07-15 21:56:13 00725_memory_tracking: [ OK ] 1.66 sec.
2026-07-15 21:56:14 03003_enum_and_string_compatible: [ OK ] 0.92 sec.
2026-07-15 21:56:14 03143_cte_scope: [ OK ] 1.26 sec.
2026-07-15 21:56:16 00318_pk_tuple_order: [ OK ] 4.29 sec.
2026-07-15 21:56:16 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 1.81 sec.
2026-07-15 21:56:17 00553_buff_exists_materlized_column: [ OK ] 1.38 sec.
2026-07-15 21:56:18 02456_test_zero_copy_mutation: [ OK ] 1.95 sec.
2026-07-15 21:56:19 02554_log_faminy_support_storage_policy: [ OK ] 1.70 sec.
2026-07-15 21:56:19 01732_union_and_union_all: [ OK ] 1.09 sec.
2026-07-15 21:56:20 02480_analyzer_alias_nullptr: [ OK ] 1.04 sec.
2026-07-15 21:56:24 01620_fix_simple_state_arg_type: [ OK ] 3.15 sec.
2026-07-15 21:56:24 02149_schema_inference_create_table_syntax: [ OK ] 17.43 sec.
2026-07-15 21:56:25 01665_substring_ubsan: [ OK ] 0.93 sec.
2026-07-15 21:56:25 01560_crash_in_agg_empty_arglist: [ OK ] 5.88 sec.
2026-07-15 21:56:26 01736_null_as_default: [ OK ] 1.11 sec.
2026-07-15 21:56:27 02029_test_implemented_methods: [ OK ] 2.64 sec.
2026-07-15 21:56:28 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 13.21 sec.
2026-07-15 21:56:31 01783_merge_engine_join_key_condition: [ OK ] 3.62 sec.
2026-07-15 21:56:31 00173_compare_date_time_with_constant_string: [ OK ] 6.02 sec.
2026-07-15 21:56:32 02400_memory_accounting_on_error: [ OK ] 6.26 sec.
2026-07-15 21:56:32 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec.
2026-07-15 21:56:32 Reason: not running for current build
2026-07-15 21:56:33 02705_settings_check_changed_flag: [ OK ] 5.17 sec.
2026-07-15 21:56:33 00619_extract: [ OK ] 1.37 sec.
2026-07-15 21:56:33 00192_least_greatest: [ OK ] 1.78 sec.
2026-07-15 21:56:34 02893_bad_sample_view: [ OK ] 0.99 sec.
2026-07-15 21:56:34 03215_multilinestring_geometry: [ OK ] 1.56 sec.
2026-07-15 21:56:35 01529_union_distinct_and_setting_union_default_mode: [ OK ] 2.16 sec.
2026-07-15 21:56:36 01825_type_json_field: [ OK ] 1.55 sec.
2026-07-15 21:56:36 03002_map_array_functions_with_low_cardinality: [ OK ] 0.80 sec.
2026-07-15 21:56:37 00356_analyze_aggregations_and_union_all: [ OK ] 0.95 sec.
2026-07-15 21:56:37 00492_drop_temporary_table: [ OK ] 1.05 sec.
2026-07-15 21:56:37 00908_bloom_filter_index: [ OK ] 47.97 sec.
2026-07-15 21:56:38 03023_invalid_format_detection: [ OK ] 3.03 sec.
2026-07-15 21:56:39 00853_join_with_nulls_crash: [ OK ] 1.85 sec.
2026-07-15 21:56:39 02181_dictionary_attach_detach: [ OK ] 1.41 sec.
2026-07-15 21:56:39 01293_pretty_max_value_width: [ OK ] 1.71 sec.
2026-07-15 21:56:39 01300_wkt: [ OK ] 1.82 sec.
2026-07-15 21:56:39 01044_h3_edge_angle: [ OK ] 0.90 sec.
2026-07-15 21:56:40 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.86 sec.
2026-07-15 21:56:41 03107_ill_formed_select_in_materialized_view: [ OK ] 1.10 sec.
2026-07-15 21:56:41 00622_select_in_parens: [ OK ] 0.79 sec.
2026-07-15 21:56:42 02706_kolmogorov_smirnov_test: [ OK ] 2.01 sec.
2026-07-15 21:56:42 01107_join_right_table_totals: [ OK ] 3.17 sec.
2026-07-15 21:56:43 02535_ip_parser_not_whole: [ OK ] 0.89 sec.
2026-07-15 21:56:43 02771_ignore_data_skipping_indices: [ OK ] 1.71 sec.
2026-07-15 21:56:44 00804_test_alter_compression_codecs: [ OK ] 45.03 sec.
2026-07-15 21:56:45 01276_system_licenses: [ OK ] 0.99 sec.
2026-07-15 21:56:45 02845_parquet_odd_decimals: [ OK ] 5.04 sec.
2026-07-15 21:56:46 01780_column_sparse_tuple: [ OK ] 2.21 sec.
2026-07-15 21:56:46 01663_aes_msan: [ OK ] 0.85 sec.
2026-07-15 21:56:47 01853_s2_cells_intersect: [ OK ] 0.95 sec.
2026-07-15 21:56:47 02561_temporary_table_grants: [ OK ] 14.55 sec.
2026-07-15 21:56:47 01095_tpch_like_smoke: [ OK ] 5.58 sec.
2026-07-15 21:56:49 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 2.71 sec.
2026-07-15 21:56:49 03034_dynamic_conversions: [ OK ] 2.46 sec.
2026-07-15 21:56:51 00444_join_use_nulls: [ OK ] 1.86 sec.
2026-07-15 21:56:51 00372_cors_header: [ OK ] 2.21 sec.
2026-07-15 21:56:52 02165_h3_edge_length_km: [ OK ] 1.24 sec.
2026-07-15 21:56:53 00909_ngram_distance: [ OK ] 10.36 sec.
2026-07-15 21:56:53 02304_grouping_set_order_by: [ OK ] 0.95 sec.
2026-07-15 21:56:54 00053_all_inner_join: [ OK ] 0.85 sec.
2026-07-15 21:56:54 00155_long_merges: [ SKIPPED ] 0.00 sec.
2026-07-15 21:56:54 Reason: not running for current build
2026-07-15 21:56:55 02021_create_database_with_comment: [ OK ] 9.38 sec.
2026-07-15 21:56:55 02915_analyzer_fuzz_5: [ OK ] 1.28 sec.
2026-07-15 21:56:55 02941_variant_type_4: [ OK ] 185.97 sec.
2026-07-15 21:56:56 02019_multiple_weird_with_fill: [ OK ] 0.85 sec.
2026-07-15 21:56:57 03093_bug_gcd_codec: [ OK ] 1.76 sec.
2026-07-15 21:56:58 02269_bool_map_sync_after_error: [ OK ] 10.48 sec.
2026-07-15 21:56:58 02790_client_max_opening_fd: [ OK ] 2.96 sec.
2026-07-15 21:56:58 01660_join_or_all: [ OK ] 4.33 sec.
2026-07-15 21:56:58 01300_group_by_other_keys_having: [ OK ] 11.27 sec.
2026-07-15 21:56:58 01010_pmj_skip_blocks: [ OK ] 6.67 sec.
2026-07-15 21:56:58 03037_dynamic_merges_2_vertical_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:56:58 Reason: not running for current build
2026-07-15 21:56:59 01506_buffer_table_alter_block_structure: [ OK ] 1.30 sec.
2026-07-15 21:56:59 00181_aggregate_functions_statistics_stable: [ OK ] 2.52 sec.
2026-07-15 21:56:59 01710_projection_in_set: [ OK ] 1.55 sec.
2026-07-15 21:57:00 00116_storage_set: [ OK ] 1.75 sec.
2026-07-15 21:57:00 01351_geohash_assert: [ OK ] 0.80 sec.
2026-07-15 21:57:00 00610_materialized_view_forward_alter_partition_statements: [ OK ] 1.51 sec.
2026-07-15 21:57:00 01071_in_array: [ OK ] 0.99 sec.
2026-07-15 21:57:01 02009_body_query_params: [ OK ] 2.41 sec.
2026-07-15 21:57:01 00090_union_race_conditions_1: [ OK ] 75.64 sec.
2026-07-15 21:57:01 02476_query_parameters_without_serialisation: [ OK ] 1.56 sec.
2026-07-15 21:57:01 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.85 sec.
2026-07-15 21:57:02 00933_alter_ttl: [ OK ] 1.96 sec.
2026-07-15 21:57:02 03095_msan_uuid_string_to_num: [ OK ] 0.96 sec.
2026-07-15 21:57:02 01451_detach_drop_part: [ OK ] 1.96 sec.
2026-07-15 21:57:03 02881_system_detached_parts_modification_time: [ OK ] 1.61 sec.
2026-07-15 21:57:03 02293_h3_hex_ring: [ OK ] 1.92 sec.
2026-07-15 21:57:04 01603_decimal_mult_float: [ OK ] 1.96 sec.
2026-07-15 21:57:04 01410_full_join_and_null_predicates: [ OK ] 2.34 sec.
2026-07-15 21:57:05 01083_match_zero_byte: [ OK ] 1.20 sec.
2026-07-15 21:57:06 02504_disallow_arrayjoin_in_mutations: [ OK ] 1.11 sec.
2026-07-15 21:57:06 01147_partial_merge_full_join: [ OK ] 7.91 sec.
2026-07-15 21:57:06 02317_distinct_in_order_optimization: [ OK ] 8.06 sec.
2026-07-15 21:57:06 01451_wrong_error_long_query: [ OK ] 2.38 sec.
2026-07-15 21:57:07 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.95 sec.
2026-07-15 21:57:07 02517_uuid_parsing: [ OK ] 1.00 sec.
2026-07-15 21:57:07 01409_topK_merge: [ OK ] 1.61 sec.
2026-07-15 21:57:08 01825_new_type_json_3: [ OK ] 4.68 sec.
2026-07-15 21:57:08 02904_empty_order_by_with_setting_enabled: [ OK ] 5.49 sec.
2026-07-15 21:57:08 01079_alter_default_zookeeper_long: [ OK ] 3.32 sec.
2026-07-15 21:57:08 01774_tuple_null_in: [ OK ] 0.91 sec.
2026-07-15 21:57:08 02970_visible_width_behavior: [ OK ] 1.16 sec.
2026-07-15 21:57:09 02552_client_format_settings: [ OK ] 0.91 sec.
2026-07-15 21:57:09 03008_deduplication_wrong_mv: [ OK ] 1.15 sec.
2026-07-15 21:57:09 00940_max_parts_in_total: [ OK ] 1.21 sec.
2026-07-15 21:57:10 00944_ml_test: [ OK ] 1.26 sec.
2026-07-15 21:57:10 02844_table_function_url_filter_by_virtual_columns: [ OK ] 3.32 sec.
2026-07-15 21:57:10 01014_function_repeat_corner_cases: [ OK ] 1.26 sec.
2026-07-15 21:57:11 01548_create_table_compound_column_format: [ OK ] 2.51 sec.
2026-07-15 21:57:11 03205_system_sync_replica_format: [ OK ] 0.85 sec.
2026-07-15 21:57:12 01580_column_const_comparision: [ OK ] 0.85 sec.
2026-07-15 21:57:18 02908_Npy_files_caching: [ OK ] 8.67 sec.
2026-07-15 21:57:18 02245_make_datetime64: [ OK ] 8.26 sec.
2026-07-15 21:57:20 01673_test_toMinute_mysql_dialect: [ OK ] 1.24 sec.
2026-07-15 21:57:24 02969_functions_to_subcolumns_if_null: [ OK ] 4.00 sec.
2026-07-15 21:57:24 01231_operator_null_in: [ OK ] 23.24 sec.
2026-07-15 21:57:25 02903_client_insert_in_background: [ OK ] 6.83 sec.
2026-07-15 21:57:25 00007_array: [ OK ] 1.09 sec.
2026-07-15 21:57:26 00763_create_query_as_table_engine_bug: [ OK ] 1.59 sec.
2026-07-15 21:57:28 02112_delayed_clickhouse_local: [ OK ] 2.78 sec.
2026-07-15 21:57:29 02366_kql_native_interval_format: [ OK ] 3.58 sec.
2026-07-15 21:57:32 02179_bool_type: [ OK ] 6.47 sec.
2026-07-15 21:57:33 02047_log_family_data_file_sizes: [ OK ] 26.00 sec.
2026-07-15 21:57:35 02311_create_table_with_unknown_format: [ OK ] 1.64 sec.
2026-07-15 21:57:36 01471_top_k_range_check: [ OK ] 1.06 sec.
2026-07-15 21:57:37 00972_geohashesInBox: [ OK ] 25.33 sec.
2026-07-15 21:57:38 01497_now_support_timezone: [ OK ] 1.12 sec.
2026-07-15 21:57:40 01051_new_any_join_engine: [ OK ] 11.10 sec.
2026-07-15 21:57:42 00647_multiply_aggregation_state: [ OK ] 4.64 sec.
2026-07-15 21:57:43 02943_order_by_all: [ OK ] 6.02 sec.
2026-07-15 21:57:43 02565_update_empty_nested: [ OK ] 10.63 sec.
2026-07-15 21:57:43 00217_shard_global_subquery_columns_with_same_name: [ OK ] 2.63 sec.
2026-07-15 21:57:43 01663_test_toDate_mysql_compatibility: [ OK ] 0.93 sec.
2026-07-15 21:57:44 00196_float32_formatting: [ OK ] 1.21 sec.
2026-07-15 21:57:44 01922_sum_null_for_remote: [ OK ] 0.91 sec.
2026-07-15 21:57:45 01774_case_sensitive_connection_id: [ OK ] 0.79 sec.
2026-07-15 21:57:46 00991_system_parts_race_condition_long: [ OK ] 36.33 sec.
2026-07-15 21:57:46 00804_test_custom_compression_codecs: [ OK ] 34.10 sec.
2026-07-15 21:57:46 02883_array_scalar_mult_div_modulo: [ OK ] 1.76 sec.
2026-07-15 21:57:46 01389_filter_by_virtual_columns: [ OK ] 0.89 sec.
2026-07-15 21:57:47 01802_rank_corr_mann_whitney_over_window: [ OK ] 1.06 sec.
2026-07-15 21:57:47 01377_supertype_low_cardinality: [ OK ] 2.35 sec.
2026-07-15 21:57:48 02498_storage_join_key_positions: [ OK ] 4.62 sec.
2026-07-15 21:57:48 01848_partition_value_column: [ OK ] 1.45 sec.
2026-07-15 21:57:48 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.74 sec.
2026-07-15 21:57:49 00373_group_by_tuple: [ OK ] 0.89 sec.
2026-07-15 21:57:49 03038_nested_dynamic_merges_compact_vertical: [ SKIPPED ] 0.00 sec.
2026-07-15 21:57:49 Reason: not running for current build
2026-07-15 21:57:50 02538_alter_rename_sequence: [ OK ] 2.25 sec.
2026-07-15 21:57:50 03258_old_analyzer_const_expr_bug: [ OK ] 1.09 sec.
2026-07-15 21:57:51 00904_array_with_constant_2: [ OK ] 0.89 sec.
2026-07-15 21:57:51 00564_temporary_table_management: [ OK ] 0.69 sec.
2026-07-15 21:57:51 02523_range_const_start: [ OK ] 0.79 sec.
2026-07-15 21:57:52 02932_punycode: [ OK ] 3.27 sec.
2026-07-15 21:57:53 01017_in_unconvertible_complex_type: [ OK ] 1.10 sec.
2026-07-15 21:57:53 02971_limit_by_distributed: [ OK ] 1.34 sec.
2026-07-15 21:57:54 01825_type_json_partitions: [ OK ] 0.89 sec.
2026-07-15 21:57:56 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 2.81 sec.
2026-07-15 21:57:57 00825_protobuf_format_array_3dim: [ OK ] 6.04 sec.
2026-07-15 21:57:57 00989_parallel_parts_loading: [ OK ] 47.43 sec.
2026-07-15 21:58:00 01681_hyperscan_debug_assertion: [ OK ] 3.87 sec.
2026-07-15 21:58:02 01125_dict_ddl_cannot_add_column: [ OK ] 0.95 sec.
2026-07-15 21:58:03 02815_first_line: [ OK ] 1.19 sec.
2026-07-15 21:58:06 01670_log_comment: [ OK ] 2.71 sec.
2026-07-15 21:58:07 03036_parquet_arrow_nullable: [ OK ] 20.94 sec.
2026-07-15 21:58:11 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 17.65 sec.
2026-07-15 21:58:11 01483_merge_table_join_and_group_by: [ OK ] 4.33 sec.
2026-07-15 21:58:12 03046_column_in_block_array_join: [ OK ] 1.36 sec.
2026-07-15 21:58:12 02551_ipv4_implicit_uint64: [ OK ] 1.01 sec.
2026-07-15 21:58:13 01156_pcg_deserialization: [ OK ] 30.12 sec.
2026-07-15 21:58:13 00559_filter_array_generic: [ OK ] 0.85 sec.
2026-07-15 21:58:14 01072_json_each_row_data_in_square_brackets: [ OK ] 1.01 sec.
2026-07-15 21:58:15 02790_async_queries_in_query_log: [ OK ] 26.82 sec.
2026-07-15 21:58:16 00976_system_stop_ttl_merges: [ OK ] 2.67 sec.
2026-07-15 21:58:18 01406_carriage_return_in_tsv_csv: [ OK ] 5.56 sec.
2026-07-15 21:58:19 00577_full_join_segfault: [ OK ] 1.63 sec.
2026-07-15 21:58:21 00453_top_k: [ OK ] 1.00 sec.
2026-07-15 21:58:22 00180_attach_materialized_view: [ OK ] 1.05 sec.
2026-07-15 21:58:26 01881_join_on_conditions_merge: [ OK ] 11.19 sec.
2026-07-15 21:58:26 02814_create_index_uniq_noop: [ OK ] 0.81 sec.
2026-07-15 21:58:27 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 29.58 sec.
2026-07-15 21:58:27 02567_native_type_conversions: [ OK ] 4.73 sec.
2026-07-15 21:58:28 02815_alias_to_length: [ OK ] 1.10 sec.
2026-07-15 21:58:28 02429_combinators_in_array_reduce: [ OK ] 1.37 sec.
2026-07-15 21:58:29 03237_max_map_state_decimal_serialization: [ OK ] 0.96 sec.
2026-07-15 21:58:30 02457_tuple_of_intervals: [ OK ] 3.67 sec.
2026-07-15 21:58:30 01419_merge_tree_settings_sanity_check: [ OK ] 1.56 sec.
2026-07-15 21:58:31 02784_projections_read_in_order_bug: [ OK ] 2.35 sec.
2026-07-15 21:58:32 01353_topk_enum: [ OK ] 0.90 sec.
2026-07-15 21:58:32 02961_analyzer_low_cardinality_fuzzer: [ OK ] 1.26 sec.
2026-07-15 21:58:32 02993_lazy_index_loading: [ OK ] 16.03 sec.
2026-07-15 21:58:33 01678_great_circle_angle: [ OK ] 1.20 sec.
2026-07-15 21:58:33 02720_row_policy_column_with_dots: [ OK ] 1.16 sec.
2026-07-15 21:58:35 03119_analyzer_window_function_in_CTE_alias: [ OK ] 1.25 sec.
2026-07-15 21:58:35 02016_aggregation_spark_bar: [ OK ] 3.67 sec.
2026-07-15 21:58:36 02813_any_value: [ OK ] 1.10 sec.
2026-07-15 21:58:37 02900_window_function_with_sparse_column: [ OK ] 1.53 sec.
2026-07-15 21:58:37 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec.
2026-07-15 21:58:37 Reason: not running for current build
2026-07-15 21:58:37 02724_persist_interval_type: [ OK ] 1.61 sec.
2026-07-15 21:58:39 00978_sum_map_bugfix: [ OK ] 1.32 sec.
2026-07-15 21:58:39 02122_parallel_formatting_TSV: [ OK ] 8.57 sec.
2026-07-15 21:58:40 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 1.01 sec.
2026-07-15 21:58:42 01079_order_by_pk: [ OK ] 35.95 sec.
2026-07-15 21:58:42 02129_skip_quoted_fields: [ OK ] 26.87 sec.
2026-07-15 21:58:42 03098_prefer_column_to_alias_subquery: [ OK ] 1.93 sec.
2026-07-15 21:58:43 01326_hostname_alias: [ OK ] 0.92 sec.
2026-07-15 21:58:44 01055_prewhere_bugs: [ OK ] 1.56 sec.
2026-07-15 21:58:45 00088_distinct_of_arrays_of_strings: [ OK ] 0.85 sec.
2026-07-15 21:58:46 01474_custom_null_tsv: [ OK ] 6.81 sec.
2026-07-15 21:58:46 01031_mutations_interpreter_and_context: [ OK ] 8.73 sec.
2026-07-15 21:58:47 01825_new_type_json_bools: [ OK ] 1.00 sec.
2026-07-15 21:58:47 01632_tinylog_read_write: [ OK ] 13.92 sec.
2026-07-15 21:58:47 00048_a_stored_aggregates_merge: [ OK ] 1.67 sec.
2026-07-15 21:58:49 01700_system_zookeeper_path_in: [ OK ] 1.86 sec.
2026-07-15 21:58:49 01825_type_json_1: [ OK ] 3.17 sec.
2026-07-15 21:58:50 01822_short_circuit: [ OK ] 7.62 sec.
2026-07-15 21:58:50 03352_distinct_sorted_bug: [ OK ] 0.95 sec.
2026-07-15 21:58:50 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 1.05 sec.
2026-07-15 21:58:50 01621_clickhouse_compressor: [ OK ] 3.11 sec.
2026-07-15 21:58:51 03164_linestring_geometry: [ OK ] 0.89 sec.
2026-07-15 21:58:51 02165_h3_num_hexagons: [ OK ] 1.35 sec.
2026-07-15 21:58:52 02574_suspicious_low_cardinality_msan: [ OK ] 1.79 sec.
2026-07-15 21:58:52 00271_agg_state_and_totals: [ OK ] 0.90 sec.
2026-07-15 21:58:53 02311_normalize_utf8_constant: [ OK ] 0.79 sec.
2026-07-15 21:58:54 00313_const_totals_extremes: [ OK ] 2.61 sec.
2026-07-15 21:58:54 01825_type_json_ephemeral: [ OK ] 1.45 sec.
2026-07-15 21:58:55 01527_materialized_view_stack_overflow: [ OK ] 4.52 sec.
2026-07-15 21:58:55 00030_alter_table: [ OK ] 3.07 sec.
2026-07-15 21:58:55 03092_analyzer_same_table_name_in_different_databases: [ OK ] 1.06 sec.
2026-07-15 21:58:56 02480_suspicious_lowcard_in_key: [ OK ] 1.16 sec.
2026-07-15 21:58:56 01958_partial_hour_timezone: [ OK ] 0.96 sec.
2026-07-15 21:58:57 02125_dict_get_type_nullable_fix: [ OK ] 1.17 sec.
2026-07-15 21:58:57 02995_index_9: [ SKIPPED ] 0.00 sec.
2026-07-15 21:58:57 Reason: not running for current build
2026-07-15 21:58:57 02947_dropped_tables_parts: [ OK ] 1.32 sec.
2026-07-15 21:58:57 03151_dynamic_type_scale_max_types: [ OK ] 2.06 sec.
2026-07-15 21:58:58 02125_transform_decimal_bug: [ OK ] 1.16 sec.
2026-07-15 21:58:58 02933_replicated_database_forbid_create_as_select: [ OK ] 11.45 sec.
2026-07-15 21:58:59 02366_asof_optimize_predicate_bug_37813: [ OK ] 1.31 sec.
2026-07-15 21:58:59 03019_numbers_pretty: [ OK ] 1.22 sec.
2026-07-15 21:59:00 02125_fix_storage_filelog: [ OK ] 0.89 sec.
2026-07-15 21:59:00 02504_regexp_dictionary_ua_parser: [ OK ] 18.04 sec.
2026-07-15 21:59:00 02915_analyzer_fuzz_6: [ OK ] 1.66 sec.
2026-07-15 21:59:01 02514_bad_index_granularity: [ OK ] 0.90 sec.
2026-07-15 21:59:01 01607_arrays_as_nested_csv: [ OK ] 6.09 sec.
2026-07-15 21:59:02 02497_if_transform_strings_to_enum: [ OK ] 2.72 sec.
2026-07-15 21:59:02 03033_final_undefined_last_mark: [ OK ] 0.86 sec.
2026-07-15 21:59:02 01753_mutate_table_predicated_with_table: [ OK ] 1.41 sec.
2026-07-15 21:59:04 01821_join_table_mutation: [ OK ] 2.23 sec.
2026-07-15 21:59:04 01456_low_cardinality_sorting_bugfix: [ OK ] 2.16 sec.
2026-07-15 21:59:05 00823_sequence_match_dfa: [ OK ] 4.69 sec.
2026-07-15 21:59:06 00213_multiple_global_in: [ OK ] 0.90 sec.
2026-07-15 21:59:07 01475_read_subcolumns_2: [ OK ] 2.37 sec.
2026-07-15 21:59:09 02478_analyzer_table_expression_aliases: [ OK ] 2.06 sec.
2026-07-15 21:59:10 01776_decrypt_aead_size_check: [ OK ] 0.84 sec.
2026-07-15 21:59:11 01101_literal_column_clash: [ OK ] 1.35 sec.
2026-07-15 21:59:11 01035_avg: [ OK ] 13.08 sec.
2026-07-15 21:59:12 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.89 sec.
2026-07-15 21:59:12 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.90 sec.
2026-07-15 21:59:13 02868_operator_is_not_distinct_from_priority: [ OK ] 0.96 sec.
2026-07-15 21:59:14 01011_test_create_as_skip_indices: [ OK ] 1.14 sec.
2026-07-15 21:59:14 01670_test_repeat_mysql_dialect: [ OK ] 0.69 sec.
2026-07-15 21:59:15 00445_join_nullable_keys: [ OK ] 1.19 sec.
2026-07-15 21:59:16 02221_parallel_replicas_bug: [ OK ] 10.16 sec.
2026-07-15 21:59:16 00628_in_lambda_on_merge_table_bug: [ OK ] 1.54 sec.
2026-07-15 21:59:17 02118_deserialize_whole_text: [ OK ] 16.75 sec.
2026-07-15 21:59:17 01087_index_set_ubsan: [ OK ] 0.79 sec.
2026-07-15 21:59:18 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.84 sec.
2026-07-15 21:59:19 02422_insert_different_granularity: [ OK ] 2.70 sec.
2026-07-15 21:59:19 01031_pmj_new_any_semi_join: [ OK ] 1.84 sec.
2026-07-15 21:59:25 01019_alter_materialized_view_atomic: [ OK ] 87.06 sec.
2026-07-15 21:59:26 03145_unicode_quotes: [ OK ] 0.95 sec.
2026-07-15 21:59:27 00365_statistics_in_formats: [ OK ] 7.75 sec.
2026-07-15 21:59:28 01049_window_view_window_functions: [ OK ] 2.41 sec.
2026-07-15 21:59:29 02026_arrayDifference_const: [ OK ] 0.81 sec.
2026-07-15 21:59:31 00379_system_processes_port: [ OK ] 2.22 sec.
2026-07-15 21:59:34 01746_extract_text_from_html: [ OK ] 2.55 sec.
2026-07-15 21:59:38 02817_structure_to_schema: [ OK ] 36.13 sec.
2026-07-15 21:59:42 02346_fulltext_index_search: [ OK ] 27.77 sec.
2026-07-15 21:59:43 02966_nested_offsets_subcolumn: [ OK ] 5.10 sec.
2026-07-15 21:59:43 00726_length_aliases: [ OK ] 0.85 sec.
2026-07-15 21:59:44 00098_7_union_all: [ OK ] 0.85 sec.
2026-07-15 21:59:44 03031_tuple_elimination_analyzer: [ OK ] 0.95 sec.
2026-07-15 21:59:46 03143_parallel_replicas_mat_view_bug: [ OK ] 1.11 sec.
2026-07-15 21:59:47 00523_aggregate_functions_in_group_array: [ OK ] 1.27 sec.
2026-07-15 21:59:47 01099_operators_date_and_timestamp: [ OK ] 3.37 sec.
2026-07-15 21:59:48 03203_variant_convert_field_to_type_bug: [ OK ] 0.83 sec.
2026-07-15 21:59:49 02124_buffer_with_type_map_long: [ OK ] 14.79 sec.
2026-07-15 21:59:50 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 2.05 sec.
2026-07-15 21:59:57 01071_window_view_event_tumble_asc_join: [ OK ] 9.50 sec.
2026-07-15 21:59:59 01059_storage_file_compression: [ OK ] 55.01 sec.
2026-07-15 21:59:59 03001_backup_matview_after_modify_query: [ OK ] 10.43 sec.
2026-07-15 22:00:00 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 9.61 sec.
2026-07-15 22:00:01 02269_to_start_of_interval_overflow: [ OK ] 1.08 sec.
2026-07-15 22:00:01 00555_right_join_excessive_rows: [ OK ] 1.21 sec.
2026-07-15 22:00:02 00906_low_cardinality_rollup: [ OK ] 2.44 sec.
2026-07-15 22:00:04 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 45.86 sec.
2026-07-15 22:00:04 02571_local_desc_abort_on_twitter_json: [ OK ] 3.30 sec.
2026-07-15 22:00:05 02389_analyzer_nested_lambda: [ OK ] 37.50 sec.
2026-07-15 22:00:05 01710_projections_order_by_complete: [ OK ] 2.56 sec.
2026-07-15 22:00:07 00447_foreach_modifier: [ OK ] 1.86 sec.
2026-07-15 22:00:07 03172_dynamic_binary_serialization: [ OK ] 47.52 sec.
2026-07-15 22:00:08 01431_utf8_ubsan: [ OK ] 0.98 sec.
2026-07-15 22:00:08 02422_read_numbers_as_strings: [ OK ] 1.16 sec.
2026-07-15 22:00:08 01040_distributed_background_insert_batch_inserts: [ OK ] 3.19 sec.
2026-07-15 22:00:09 00604_show_create_database: [ OK ] 0.72 sec.
2026-07-15 22:00:10 02968_url_args: [ OK ] 1.49 sec.
2026-07-15 22:00:11 02734_sparse_columns_mutation: [ OK ] 2.83 sec.
2026-07-15 22:00:11 02004_intersect_except_distinct_operators: [ OK ] 7.19 sec.
2026-07-15 22:00:11 02157_readonly_system_suspend: [ OK ] 3.37 sec.
2026-07-15 22:00:12 02148_cast_type_parsing: [ OK ] 1.06 sec.
2026-07-15 22:00:12 03111_inner_join_group_by: [ OK ] 0.96 sec.
2026-07-15 22:00:12 02183_combinator_if: [ OK ] 7.72 sec.
2026-07-15 22:00:12 00746_sql_fuzzy: [ OK ] 163.81 sec.
2026-07-15 22:00:12 03093_filter_push_down_crash: [ OK ] 1.49 sec.
2026-07-15 22:00:13 02715_or_null: [ OK ] 1.13 sec.
2026-07-15 22:00:14 02402_merge_engine_with_view: [ OK ] 1.42 sec.
2026-07-15 22:00:15 01602_runningConcurrency: [ OK ] 2.23 sec.
2026-07-15 22:00:16 01720_join_implicit_cast: [ OK ] 13.90 sec.
2026-07-15 22:00:16 02864_statistics_predicates: [ OK ] 18.49 sec.
2026-07-15 22:00:16 00804_test_custom_compression_codes_log_storages: [ OK ] 4.39 sec.
2026-07-15 22:00:16 00061_merge_tree_alter: [ OK ] 4.01 sec.
2026-07-15 22:00:17 01225_drop_dictionary_as_table: [ OK ] 1.36 sec.
2026-07-15 22:00:18 03305_fix_kafka_table_with_kw_arguments: [ OK ] 1.13 sec.
2026-07-15 22:00:19 02359_send_logs_source_regexp: [ OK ] 3.43 sec.
2026-07-15 22:00:20 02421_json_decimals_as_strings: [ OK ] 1.75 sec.
2026-07-15 22:00:22 01926_bin_unbin: [ OK ] 5.36 sec.
2026-07-15 22:00:22 02595_orc_arrow_parquet_more_types: [ OK ] 5.91 sec.
2026-07-15 22:00:22 02918_join_pm_lc_crash: [ OK ] 2.99 sec.
2026-07-15 22:00:25 00552_or_nullable: [ OK ] 2.54 sec.
2026-07-15 22:00:26 01581_deduplicate_by_columns_local: [ OK ] 14.51 sec.
2026-07-15 22:00:26 01825_type_json_schema_inference: [ OK ] 12.23 sec.
2026-07-15 22:00:27 02695_logical_optimizer_alias_bug: [ OK ] 2.15 sec.
2026-07-15 22:00:28 02188_table_function_format: [ OK ] 1.54 sec.
2026-07-15 22:00:28 02477_age_datetime64: [ OK ] 5.82 sec.
2026-07-15 22:00:29 03224_json_merges_new_type_in_shared_data: [ OK ] 2.62 sec.
2026-07-15 22:00:29 03313_case_insensitive_json_type_declaration: [ OK ] 0.82 sec.
2026-07-15 22:00:29 03214_backup_and_clear_old_temporary_directories: [ OK ] 17.60 sec.
2026-07-15 22:00:29 03273_dictionary_rbac: [ OK ] 8.79 sec.
2026-07-15 22:00:29 02724_function_in_left_table_clause_asof_join: [ OK ] 1.12 sec.
2026-07-15 22:00:30 02950_reading_array_tuple_subcolumns: [ OK ] 13.29 sec.
2026-07-15 22:00:30 03199_has_lc_fixed_string: [ OK ] 0.95 sec.
2026-07-15 22:00:30 02294_system_certificates: [ OK ] 0.86 sec.
2026-07-15 22:00:31 02560_regexp_denial_of_service: [ OK ] 3.42 sec.
2026-07-15 22:00:31 02354_vector_search_queries: [ OK ] 2.38 sec.
2026-07-15 22:00:32 02243_in_ip_address: [ OK ] 1.54 sec.
2026-07-15 22:00:33 02842_table_function_file_filter_by_virtual_columns: [ OK ] 3.64 sec.
2026-07-15 22:00:33 00260_like_and_curly_braces: [ OK ] 3.60 sec.
2026-07-15 22:00:34 02481_pk_analysis_with_enum_to_string: [ OK ] 3.09 sec.
2026-07-15 22:00:34 01880_materialized_view_to_table_type_check: [ OK ] 2.09 sec.
2026-07-15 22:00:34 02922_respect_nulls_extensive: [ OK ] 5.21 sec.
2026-07-15 22:00:35 00320_between: [ OK ] 0.96 sec.
2026-07-15 22:00:36 01120_join_constants: [ OK ] 1.21 sec.
2026-07-15 22:00:36 02498_random_string_in_json_schema_inference: [ OK ] 3.01 sec.
2026-07-15 22:00:36 03032_variant_bool_number_not_suspicious: [ OK ] 0.95 sec.
2026-07-15 22:00:37 01763_long_ttl_group_by: [ OK ] 14.53 sec.
2026-07-15 22:00:37 02163_operators: [ OK ] 0.95 sec.
2026-07-15 22:00:37 01081_demangle: [ OK ] 0.85 sec.
2026-07-15 22:00:37 01913_names_of_tuple_literal: [ OK ] 1.00 sec.
2026-07-15 22:00:38 01456_modify_column_type_via_add_drop_update: [ OK ] 4.16 sec.
2026-07-15 22:00:39 03144_alter_column_and_read: [ OK ] 1.19 sec.
2026-07-15 22:00:39 00273_quantiles: [ OK ] 1.91 sec.
2026-07-15 22:00:39 02784_disable_async_with_dedup_correctly: [ OK ] 8.68 sec.
2026-07-15 22:00:39 00293_shard_max_subquery_depth: [ OK ] 1.60 sec.
2026-07-15 22:00:39 01049_join_low_card_crash: [ OK ] 1.61 sec.
2026-07-15 22:00:39 02025_subcolumns_compact_parts: [ OK ] 1.67 sec.
2026-07-15 22:00:40 01940_point_in_polygon_ubsan: [ OK ] 0.91 sec.
2026-07-15 22:00:40 02096_totals_global_in_bug: [ OK ] 1.48 sec.
2026-07-15 22:00:41 01666_gcd_ubsan: [ OK ] 1.42 sec.
2026-07-15 22:00:41 02681_comparsion_tuple_elimination_ast: [ OK ] 1.63 sec.
2026-07-15 22:00:41 02497_having_without_actual_aggregation_bug: [ OK ] 1.13 sec.
2026-07-15 22:00:41 00823_capnproto_input: [ OK ] 6.36 sec.
2026-07-15 22:00:42 00856_no_column_issue_4242: [ OK ] 1.37 sec.
2026-07-15 22:00:42 00882_multiple_join_no_alias: [ OK ] 1.71 sec.
2026-07-15 22:00:42 03240_insert_select_named_tuple: [ OK ] 2.08 sec.
2026-07-15 22:00:43 02560_window_ntile: [ OK ] 2.76 sec.
2026-07-15 22:00:43 01906_bigint_accurate_cast_ubsan: [ OK ] 1.77 sec.
2026-07-15 22:00:43 02990_format_not_precedence: [ OK ] 1.16 sec.
2026-07-15 22:00:43 02675_grant_query_formatting: [ OK ] 2.52 sec.
2026-07-15 22:00:43 02336_sort_optimization_with_fill: [ OK ] 0.96 sec.
2026-07-15 22:00:44 01854_HTTP_dict_decompression: [ OK ] 4.45 sec.
2026-07-15 22:00:44 02967_fuzz_bad_cast: [ OK ] 1.28 sec.
2026-07-15 22:00:44 01667_aes_args_check: [ OK ] 0.86 sec.
2026-07-15 22:00:45 01538_fuzz_aggregate: [ OK ] 0.95 sec.
2026-07-15 22:00:45 01039_mergetree_exec_time: [ OK ] 2.16 sec.
2026-07-15 22:00:45 02691_multiple_joins_backtick_identifiers: [ OK ] 1.67 sec.
2026-07-15 22:00:45 03215_varian_as_common_type_integers: [ OK ] 1.16 sec.
2026-07-15 22:00:46 00752_low_cardinality_array_result: [ OK ] 0.85 sec.
2026-07-15 22:00:46 00380_client_break_at_exception_in_batch_mode: [ OK ] 3.35 sec.
2026-07-15 22:00:46 02954_analyzer_fuzz_i57086: [ OK ] 1.32 sec.
2026-07-15 22:00:47 00009_array_join_subquery: [ OK ] 1.13 sec.
2026-07-15 22:00:47 02900_issue_55858: [ OK ] 1.91 sec.
2026-07-15 22:00:48 00585_union_all_subquery_aggregation_column_removal: [ OK ] 3.20 sec.
2026-07-15 22:00:49 00715_bounding_ratio_merge_empty: [ OK ] 1.27 sec.
2026-07-15 22:00:49 02586_generate_random_structure: [ OK ] 1.75 sec.
2026-07-15 22:00:49 01450_set_null_const: [ OK ] 1.16 sec.
2026-07-15 22:00:49 00517_date_parsing: [ OK ] 3.04 sec.
2026-07-15 22:00:50 02366_normalize_aggregate_function_types_and_states: [ OK ] 1.17 sec.
2026-07-15 22:00:50 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 1.11 sec.
2026-07-15 22:00:51 03228_variant_permutation_issue: [ OK ] 2.28 sec.
2026-07-15 22:00:51 00613_shard_distributed_max_execution_time: [ OK ] 1.22 sec.
2026-07-15 22:00:51 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 2.17 sec.
2026-07-15 22:00:52 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 1.58 sec.
2026-07-15 22:00:53 01068_parens: [ OK ] 1.01 sec.
2026-07-15 22:00:54 02155_dictionary_comment: [ OK ] 2.64 sec.
2026-07-15 22:00:54 02864_statistics_ddl: [ OK ] 10.55 sec.
2026-07-15 22:00:54 02813_float_parsing: [ OK ] 0.96 sec.
2026-07-15 22:00:54 02489_analyzer_indexes: [ OK ] 3.44 sec.
2026-07-15 22:00:55 00596_limit_on_expanded_ast: [ OK ] 3.28 sec.
2026-07-15 22:00:55 03031_filter_float64_logical_error: [ OK ] 1.20 sec.
2026-07-15 22:00:55 00429_point_in_ellipses: [ OK ] 0.96 sec.
2026-07-15 22:00:56 02502_analyzer_insert_select_crash_fix: [ OK ] 1.47 sec.
2026-07-15 22:00:58 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 11.65 sec.
2026-07-15 22:00:58 00147_alter_nested_default: [ OK ] 2.12 sec.
2026-07-15 22:00:59 00072_in_types: [ OK ] 0.90 sec.
2026-07-15 22:01:01 02254_projection_broken_part: [ OK ] 16.15 sec.
2026-07-15 22:01:03 02907_backup_restore_flatten_nested: [ OK ] 8.87 sec.
2026-07-15 22:01:04 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 8.56 sec.
2026-07-15 22:01:04 00199_ternary_operator_type_check: [ OK ] 3.32 sec.
2026-07-15 22:01:05 00118_storage_join: [ OK ] 1.51 sec.
2026-07-15 22:01:05 00800_low_cardinality_distributed_insert: [ OK ] 1.11 sec.
2026-07-15 22:01:06 03014_msan_parse_date_time: [ OK ] 1.00 sec.
2026-07-15 22:01:07 02790_url_multiple_tsv_files: [ OK ] 8.12 sec.
2026-07-15 22:01:07 02429_low_cardinality_trash: [ OK ] 2.36 sec.
2026-07-15 22:01:07 00953_constraints_operations: [ OK ] 11.98 sec.
2026-07-15 22:01:08 02490_replacing_merge_tree_is_deleted_column_transform_opt: [ OK ] 3.83 sec.
2026-07-15 22:01:08 00085_visible_width_of_tuple_of_dates: [ OK ] 0.95 sec.
2026-07-15 22:01:09 00125_array_element_of_array_of_tuple: [ OK ] 0.95 sec.
2026-07-15 22:01:09 01540_verbatim_partition_pruning: [ OK ] 2.36 sec.
2026-07-15 22:01:10 02676_trailing_commas: [ OK ] 1.15 sec.
2026-07-15 22:01:10 00843_optimize_predicate_and_rename_table: [ OK ] 1.26 sec.
2026-07-15 22:01:10 00734_timeslot: [ OK ] 1.25 sec.
2026-07-15 22:01:11 01288_shard_max_network_bandwidth: [ OK ] 4.06 sec.
2026-07-15 22:01:11 01038_array_of_unnamed_tuples: [ OK ] 1.06 sec.
2026-07-15 22:01:13 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 2.71 sec.
2026-07-15 22:01:14 02949_parallel_replicas_in_subquery: [ OK ] 2.88 sec.
2026-07-15 22:01:14 00500_point_in_polygon: [ OK ] 3.16 sec.
2026-07-15 22:01:14 01581_deduplicate_by_columns_replicated_long: [ OK ] 3.29 sec.
2026-07-15 22:01:15 00916_add_materialized_column_after: [ OK ] 1.04 sec.
2026-07-15 22:01:16 03199_unbin_buffer_overflow: [ OK ] 22.22 sec.
2026-07-15 22:01:17 02344_analyzer_multiple_aliases_for_expression: [ OK ] 1.39 sec.
2026-07-15 22:01:17 01825_new_type_json_9: [ OK ] 1.05 sec.
2026-07-15 22:01:17 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec.
2026-07-15 22:01:17 Reason: not running for current build
2026-07-15 22:01:18 02932_idna: [ OK ] 5.18 sec.
2026-07-15 22:01:24 01927_query_views_log_current_database: [ OK ] 7.34 sec.
2026-07-15 22:01:25 00952_input_function: [ OK ] 25.59 sec.
2026-07-15 22:01:25 02267_file_globs_schema_inference: [ OK ] 7.96 sec.
2026-07-15 22:01:25 01825_type_json_13: [ OK ] 7.58 sec.
2026-07-15 22:01:26 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.85 sec.
2026-07-15 22:01:27 00647_histogram: [ OK ] 1.36 sec.
2026-07-15 22:01:27 01542_collate_in_array: [ OK ] 1.50 sec.
2026-07-15 22:01:27 00639_startsWith: [ OK ] 1.31 sec.
2026-07-15 22:01:30 01562_agg_null_for_empty_ahead: [ OK ] 2.42 sec.
2026-07-15 22:01:31 02806_cte_block_cannot_be_empty: [ OK ] 0.95 sec.
2026-07-15 22:01:31 01283_strict_resize_bug: [ OK ] 3.52 sec.
2026-07-15 22:01:31 03156_default_multiquery_split: [ OK ] 4.48 sec.
2026-07-15 22:01:32 03443_projection_sparse: [ OK ] 1.46 sec.
2026-07-15 22:01:32 01852_s2_get_neighbours: [ OK ] 0.91 sec.
2026-07-15 22:01:33 00169_join_constant_keys: [ OK ] 0.85 sec.
2026-07-15 22:01:33 01274_generate_random_nested: [ OK ] 2.36 sec.
2026-07-15 22:01:33 02525_analyzer_function_in_crash_fix: [ OK ] 1.00 sec.
2026-07-15 22:01:34 02241_parquet_bad_column: [ OK ] 9.95 sec.
2026-07-15 22:01:34 01881_to_week_monotonic_fix: [ OK ] 1.15 sec.
2026-07-15 22:01:35 02345_create_table_allow_trailing_comma: [ OK ] 1.25 sec.
2026-07-15 22:01:35 03290_limit_by_segv: [ OK ] 0.89 sec.
2026-07-15 22:01:36 02949_ttl_group_by_bug: [ OK ] 1.40 sec.
2026-07-15 22:01:36 01014_count_of_merges_metrics: [ OK ] 1.22 sec.
2026-07-15 22:01:37 01053_drop_database_mat_view: [ OK ] 1.30 sec.
2026-07-15 22:01:38 02501_analyzer_expired_context_crash_fix: [ OK ] 1.00 sec.
2026-07-15 22:01:39 02115_write_buffers_finalize: [ OK ] 25.59 sec.
2026-07-15 22:01:40 02285_hex_bin_support_more_types: [ OK ] 2.31 sec.
2026-07-15 22:01:40 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec.
2026-07-15 22:01:40 Reason: not running for current build
2026-07-15 22:01:40 01654_test_writer_block_sequence: [ OK ] 25.99 sec.
2026-07-15 22:01:40 02250_lots_of_columns_in_csv_with_names: [ OK ] 6.85 sec.
2026-07-15 22:01:41 02916_set_formatting: [ OK ] 1.12 sec.
2026-07-15 22:01:41 02969_archive_seek: [ OK ] 3.23 sec.
2026-07-15 22:01:41 03171_direct_dict_short_circuit_bug: [ OK ] 1.26 sec.
2026-07-15 22:01:41 00714_alter_uuid: [ OK ] 1.76 sec.
2026-07-15 22:01:42 03105_table_aliases_in_mv: [ OK ] 1.47 sec.
2026-07-15 22:01:42 02251_last_day_of_month: [ OK ] 1.25 sec.
2026-07-15 22:01:44 00426_nulls_sorting: [ OK ] 1.79 sec.
2026-07-15 22:01:44 02841_parallel_replicas_summary: [ OK ] 9.32 sec.
2026-07-15 22:01:45 02721_url_cluster: [ OK ] 3.32 sec.
2026-07-15 22:01:46 01125_generate_random_qoega: [ OK ] 4.48 sec.
2026-07-15 22:01:47 03157_dynamic_type_json: [ OK ] 1.20 sec.
2026-07-15 22:01:47 01755_shard_pruning_with_literal: [ OK ] 1.21 sec.
2026-07-15 22:01:48 00623_truncate_table: [ OK ] 3.51 sec.
2026-07-15 22:01:49 01657_test_toHour_mysql_compatibility: [ OK ] 0.95 sec.
2026-07-15 22:01:49 02155_parse_date_lowcard_default_throw: [ OK ] 0.79 sec.
2026-07-15 22:01:50 02782_avro_decimals: [ OK ] 3.12 sec.
2026-07-15 22:01:50 02426_to_string_nullable_fixedstring: [ OK ] 0.84 sec.
2026-07-15 22:01:51 00411_long_accurate_number_comparison_int2: [ OK ] 79.84 sec.
2026-07-15 22:01:52 03262_column_sizes_with_dynamic_structure: [ OK ] 10.19 sec.
2026-07-15 22:01:52 02840_merge__table_or_filter: [ OK ] 2.32 sec.
2026-07-15 22:01:52 02149_issue_32487: [ OK ] 0.73 sec.
2026-07-15 22:01:53 02287_ephemeral_format_crash: [ OK ] 0.85 sec.
2026-07-15 22:01:53 01476_right_full_join_switch: [ OK ] 1.74 sec.
2026-07-15 22:01:53 01622_defaults_for_url_engine: [ OK ] 2.96 sec.
2026-07-15 22:01:54 00540_bad_data_types: [ OK ] 13.81 sec.
2026-07-15 22:01:55 02968_analyzer_join_column_not_found: [ OK ] 0.94 sec.
2026-07-15 22:01:55 01519_topK_distributed_parametrized: [ OK ] 1.95 sec.
2026-07-15 22:01:57 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 9.62 sec.
2026-07-15 22:01:57 02596_build_set_and_remote: [ OK ] 3.90 sec.
2026-07-15 22:01:57 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 2.13 sec.
2026-07-15 22:01:58 01018_ambiguous_column: [ OK ] 1.34 sec.
2026-07-15 22:01:58 01272_suspicious_codecs: [ OK ] 3.67 sec.
2026-07-15 22:01:58 02458_empty_hdfs_url: [ OK ] 0.90 sec.
2026-07-15 22:01:59 00545_weird_aggregate_functions: [ OK ] 0.91 sec.
2026-07-15 22:01:59 03143_group_by_constant_secondary: [ OK ] 0.96 sec.
2026-07-15 22:02:00 01523_client_local_queries_file_parameter: [ OK ] 6.13 sec.
2026-07-15 22:02:00 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 7.53 sec.
2026-07-15 22:02:00 00534_functions_bad_arguments8: [ OK ] 51.87 sec.
2026-07-15 22:02:01 00362_great_circle_distance: [ OK ] 1.11 sec.
2026-07-15 22:02:02 01010_partial_merge_join_const_and_lc: [ OK ] 1.75 sec.
2026-07-15 22:02:02 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 1.27 sec.
2026-07-15 22:02:03 02941_projections_external_aggregation: [ OK ] 5.58 sec.
2026-07-15 22:02:03 02995_forget_partition: [ OK ] 18.83 sec.
2026-07-15 22:02:03 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 1.05 sec.
2026-07-15 22:02:03 01436_storage_merge_with_join_push_down: [ OK ] 1.57 sec.
2026-07-15 22:02:04 02407_array_element_from_map_wrong_type: [ OK ] 0.85 sec.
2026-07-15 22:02:04 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 1.46 sec.
2026-07-15 22:02:05 00737_decimal_group_by: [ OK ] 1.21 sec.
2026-07-15 22:02:05 01113_local_dictionary_type_conversion: [ OK ] 1.15 sec.
2026-07-15 22:02:06 03680_loop_table_function_access_check: [ OK ] 6.14 sec.
2026-07-15 22:02:06 01945_show_debug_warning: [ OK ] 6.15 sec.
2026-07-15 22:02:06 02783_parsedatetimebesteffort_syslog: [ OK ] 1.11 sec.
2026-07-15 22:02:06 01932_global_in_function: [ OK ] 1.05 sec.
2026-07-15 22:02:07 00554_nested_and_table_engines: [ OK ] 2.20 sec.
2026-07-15 22:02:07 02353_ascii: [ OK ] 0.89 sec.
2026-07-15 22:02:07 02384_analyzer_dict_get_join_get: [ OK ] 1.60 sec.
2026-07-15 22:02:08 00098_a_union_all: [ OK ] 0.74 sec.
2026-07-15 22:02:08 02011_tuple_vector_functions: [ OK ] 4.57 sec.
2026-07-15 22:02:08 02932_kill_query_sleep: [ OK ] 9.41 sec.
2026-07-15 22:02:09 01674_unicode_asan: [ OK ] 1.20 sec.
2026-07-15 22:02:11 00974_fix_join_on: [ OK ] 3.47 sec.
2026-07-15 22:02:12 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 2.61 sec.
2026-07-15 22:02:12 01576_alias_column_rewrite: [ OK ] 4.17 sec.
2026-07-15 22:02:12 00360_to_date_from_string_with_datetime: [ OK ] 0.85 sec.
2026-07-15 22:02:13 03087_analyzer_subquery_with_alias: [ OK ] 0.89 sec.
2026-07-15 22:02:14 03134_positional_arguments: [ OK ] 7.84 sec.
2026-07-15 22:02:15 01018_ddl_dictionaries_special: [ OK ] 2.30 sec.
2026-07-15 22:02:15 00402_nan_and_extremes: [ OK ] 1.00 sec.
2026-07-15 22:02:16 02967_index_hint_crash: [ OK ] 1.05 sec.
2026-07-15 22:02:16 01676_range_hashed_dictionary: [ OK ] 3.41 sec.
2026-07-15 22:02:16 02582_analyzer_join_subquery_empty_column_list: [ OK ] 1.55 sec.
2026-07-15 22:02:17 03002_int_div_decimal_with_date_bug: [ OK ] 1.06 sec.
2026-07-15 22:02:18 02922_respect_nulls_parser: [ OK ] 1.66 sec.
2026-07-15 22:02:19 02810_async_insert_dedup_replicated_collapsing: [ OK ] 18.67 sec.
2026-07-15 22:02:19 03058_analyzer_ambiguous_columns: [ OK ] 1.15 sec.
2026-07-15 22:02:20 02122_parallel_formatting_TSVWithNames: [ OK ] 7.75 sec.
2026-07-15 22:02:20 00191_aggregating_merge_tree_and_final: [ OK ] 1.45 sec.
2026-07-15 22:02:21 03261_json_hints_types_check: [ OK ] 1.31 sec.
2026-07-15 22:02:21 01056_predicate_optimizer_bugs: [ OK ] 3.94 sec.
2026-07-15 22:02:22 00674_join_on_syntax: [ OK ] 6.48 sec.
2026-07-15 22:02:23 01385_not_function: [ OK ] 0.84 sec.
2026-07-15 22:02:23 02125_lz4_compression_bug_Values: [ OK ] 16.49 sec.
2026-07-15 22:02:24 00666_uniq_complex_types: [ OK ] 2.41 sec.
2026-07-15 22:02:24 02368_analyzer_table_functions: [ OK ] 1.05 sec.
2026-07-15 22:02:24 02155_nested_lc_defalut_bug: [ OK ] 1.11 sec.
2026-07-15 22:02:25 02455_extract_fixed_string_from_nested_json: [ OK ] 1.00 sec.
2026-07-15 22:02:25 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 4.12 sec.
2026-07-15 22:02:25 02234_position_case_insensitive_utf8: [ OK ] 0.97 sec.
2026-07-15 22:02:26 02500_analyzer_storage_view_crash_fix: [ OK ] 1.30 sec.
2026-07-15 22:02:26 01558_ttest_scipy: [ OK ] 6.49 sec.
2026-07-15 22:02:27 02316_cast_to_ip_address_default_column: [ OK ] 1.35 sec.
2026-07-15 22:02:27 00916_join_using_duplicate_columns: [ OK ] 1.96 sec.
2026-07-15 22:02:27 03169_cache_complex_dict_short_circuit_bug: [ OK ] 1.25 sec.
2026-07-15 22:02:27 01561_aggregate_functions_of_key_with_join: [ OK ] 1.20 sec.
2026-07-15 22:02:28 00569_parse_date_time_best_effort: [ OK ] 0.85 sec.
2026-07-15 22:02:28 03007_column_nullable_uninitialzed_value: [ OK ] 0.84 sec.
2026-07-15 22:02:28 02098_date32_comparison: [ OK ] 1.56 sec.
2026-07-15 22:02:29 01480_binary_operator_monotonicity: [ OK ] 3.12 sec.
2026-07-15 22:02:29 02122_parallel_formatting_JSONEachRow: [ OK ] 8.25 sec.
2026-07-15 22:02:29 01020_function_char: [ OK ] 0.85 sec.
2026-07-15 22:02:29 01835_alias_to_primary_key_cyfdecyf: [ OK ] 1.15 sec.
2026-07-15 22:02:30 01271_show_privileges: [ OK ] 0.89 sec.
2026-07-15 22:02:30 02177_sum_if_not_found: [ OK ] 1.42 sec.
2026-07-15 22:02:30 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 1.60 sec.
2026-07-15 22:02:31 01518_cast_nullable_virtual_system_column: [ OK ] 1.09 sec.
2026-07-15 22:02:31 02499_analyzer_set_index: [ OK ] 1.10 sec.
2026-07-15 22:02:31 02030_rocksdb_race_long: [ OK ] 24.04 sec.
2026-07-15 22:02:32 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.80 sec.
2026-07-15 22:02:34 02841_group_array_sorted: [ OK ] 3.31 sec.
2026-07-15 22:02:34 02752_space_function: [ OK ] 2.60 sec.
2026-07-15 22:02:35 02911_analyzer_explain_estimate: [ OK ] 0.85 sec.
2026-07-15 22:02:36 02521_tsv_csv_custom_header_detection: [ OK ] 30.04 sec.
2026-07-15 22:02:36 02486_truncate_and_unexpected_parts: [ OK ] 5.22 sec.
2026-07-15 22:02:37 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 1.61 sec.
2026-07-15 22:02:37 00746_compile_non_deterministic_function: [ OK ] 7.40 sec.
2026-07-15 22:02:37 00275_shard_quantiles_weighted: [ OK ] 3.21 sec.
2026-07-15 22:02:38 01076_range_reader_segfault: [ OK ] 1.04 sec.
2026-07-15 22:02:38 02864_profile_event_part_lock: [ OK ] 0.90 sec.
2026-07-15 22:02:38 01418_index_analysis_bug: [ OK ] 1.35 sec.
2026-07-15 22:02:39 03251_unaligned_window_function_state: [ OK ] 1.25 sec.
2026-07-15 22:02:39 02009_array_join_partition: [ OK ] 0.99 sec.
2026-07-15 22:02:39 03276_functions_to_subcolumns_lc: [ OK ] 0.99 sec.
2026-07-15 22:02:39 02476_fix_lambda_parsing: [ OK ] 2.70 sec.
2026-07-15 22:02:39 02134_async_inserts_formats: [ OK ] 10.88 sec.
2026-07-15 22:02:40 01034_values_parse_float_bug: [ OK ] 7.74 sec.
2026-07-15 22:02:40 00075_shard_formatting_negate_of_negative_literal: [ OK ] 1.32 sec.
2026-07-15 22:02:41 02950_part_log_bytes_uncompressed: [ OK ] 3.06 sec.
2026-07-15 22:02:41 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 1.45 sec.
2026-07-15 22:02:41 02811_insert_schema_inference: [ OK ] 1.08 sec.
2026-07-15 22:02:42 00368_format_option_collision: [ OK ] 3.13 sec.
2026-07-15 22:02:43 02869_http_headers_elapsed_ns: [ OK ] 2.31 sec.
2026-07-15 22:02:44 02473_extract_low_cardinality_from_json: [ OK ] 1.01 sec.
2026-07-15 22:02:45 03262_test_parquet_native_reader_int_logical_type: [ OK ] 4.13 sec.
2026-07-15 22:02:45 01890_jit_aggregation_function_sum_long: [ OK ] 6.10 sec.
2026-07-15 22:02:45 01137_sample_final: [ OK ] 1.25 sec.
2026-07-15 22:02:46 01641_memory_tracking_insert_optimize: [ OK ] 4.74 sec.
2026-07-15 22:02:47 03205_json_cast_from_string: [ OK ] 2.51 sec.
2026-07-15 22:02:47 01550_mutation_subquery: [ OK ] 1.51 sec.
2026-07-15 22:02:47 02985_minmax_index_aggregate_function: [ OK ] 1.86 sec.
2026-07-15 22:02:48 03096_largest_triangle_3b_crash: [ OK ] 0.85 sec.
2026-07-15 22:02:49 02597_column_delete_and_replication: [ OK ] 3.66 sec.
2026-07-15 22:02:49 02535_json_bson_each_row_curl: [ OK ] 6.34 sec.
2026-07-15 22:02:49 02184_range_hashed_dictionary_outside_range_values: [ OK ] 1.31 sec.
2026-07-15 22:02:49 00973_uniq_non_associativity: [ OK ] 8.11 sec.
2026-07-15 22:02:50 01603_remove_column_ttl: [ OK ] 1.36 sec.
2026-07-15 22:02:51 01390_remove_injective_in_uniq: [ OK ] 1.57 sec.
2026-07-15 22:02:51 02426_pod_array_overflow_3: [ OK ] 0.88 sec.
2026-07-15 22:02:51 02377_modify_column_from_lc: [ OK ] 2.56 sec.
2026-07-15 22:02:51 00808_not_optimize_predicate: [ OK ] 2.31 sec.
2026-07-15 22:02:52 00590_limit_by_column_removal: [ OK ] 0.95 sec.
2026-07-15 22:02:52 02911_cte_invalid_query_analysis: [ OK ] 1.15 sec.
2026-07-15 22:02:53 02475_analysis_of_variance: [ OK ] 1.29 sec.
2026-07-15 22:02:53 02354_tuple_element_with_default: [ OK ] 1.35 sec.
2026-07-15 22:02:53 02227_union_match_by_name: [ OK ] 0.90 sec.
2026-07-15 22:02:53 00954_client_prepared_statements: [ OK ] 13.94 sec.
2026-07-15 22:02:54 01891_partition_by_uuid: [ OK ] 0.94 sec.
2026-07-15 22:02:54 02785_left_anti_join_bug: [ OK ] 1.30 sec.
2026-07-15 22:02:55 01662_date_ubsan: [ OK ] 2.16 sec.
2026-07-15 22:02:55 02487_create_index_normalize_functions: [ OK ] 1.50 sec.
2026-07-15 22:02:56 00520_http_nullable: [ OK ] 2.36 sec.
2026-07-15 22:02:56 02475_analyzer_join_tree_subquery: [ OK ] 1.05 sec.
2026-07-15 22:02:56 02223_h3_test_const_columns: [ OK ] 2.41 sec.
2026-07-15 22:02:56 02477_invalid_reads: [ OK ] 2.67 sec.
2026-07-15 22:02:56 00135_duplicate_group_by_keys_segfault: [ OK ] 0.55 sec.
2026-07-15 22:02:58 00810_in_operators_segfault: [ OK ] 0.99 sec.
2026-07-15 22:02:58 01097_cyclic_defaults: [ OK ] 1.70 sec.
2026-07-15 22:02:59 02686_bson3: [ OK ] 0.92 sec.
2026-07-15 22:02:59 01387_clear_column_default_depends: [ OK ] 2.48 sec.
2026-07-15 22:02:59 01532_collate_in_low_cardinality: [ OK ] 1.51 sec.
2026-07-15 22:03:00 01011_group_uniq_array_memsan: [ OK ] 0.90 sec.
2026-07-15 22:03:01 01787_map_remote: [ OK ] 1.50 sec.
2026-07-15 22:03:01 02669_alter_modify_to_nullable: [ OK ] 5.93 sec.
2026-07-15 22:03:02 02555_davengers_rename_chain: [ OK ] 13.11 sec.
2026-07-15 22:03:02 02971_functions_to_subcolumns_variant: [ OK ] 1.16 sec.
2026-07-15 22:03:03 02782_values_null_to_lc_nullable: [ OK ] 0.84 sec.
2026-07-15 22:03:03 02225_hints_for_indeices: [ OK ] 6.79 sec.
2026-07-15 22:03:03 02414_all_new_table_functions_must_be_documented: [ OK ] 0.90 sec.
2026-07-15 22:03:06 02104_clickhouse_local_columns_description: [ OK ] 2.60 sec.
2026-07-15 22:03:07 02811_parallel_replicas_prewhere_count: [ OK ] 1.31 sec.
2026-07-15 22:03:08 02294_floating_point_second_in_settings: [ OK ] 7.39 sec.
2026-07-15 22:03:08 00522_multidimensional: [ OK ] 5.58 sec.
2026-07-15 22:03:10 03064_analyzer_named_subqueries: [ OK ] 1.26 sec.
2026-07-15 22:03:10 00844_join_lightee2: [ OK ] 1.20 sec.
2026-07-15 22:03:10 01825_new_type_json_12: [ OK ] 10.48 sec.
2026-07-15 22:03:11 00073_merge_sorting_empty_array_joined: [ OK ] 0.90 sec.
2026-07-15 22:03:11 01282_system_parts_ttl_info: [ OK ] 1.32 sec.
2026-07-15 22:03:11 00738_nested_merge_multidimensional_array: [ OK ] 1.44 sec.
2026-07-15 22:03:12 01333_select_abc_asterisk: [ OK ] 0.95 sec.
2026-07-15 22:03:12 00649_quantile_tdigest_negative: [ OK ] 1.05 sec.
2026-07-15 22:03:13 02737_sql_auto_is_null: [ OK ] 0.90 sec.
2026-07-15 22:03:14 01083_cross_to_inner_with_in_bug: [ OK ] 1.15 sec.
2026-07-15 22:03:14 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 1.21 sec.
2026-07-15 22:03:15 02354_with_statement_non_exist_column: [ OK ] 0.95 sec.
2026-07-15 22:03:15 02731_replace_partition_from_temporary_table: [ OK ] 3.86 sec.
2026-07-15 22:03:16 02346_read_in_order_fixed_prefix: [ OK ] 49.07 sec.
2026-07-15 22:03:18 02132_client_history_navigation: [ OK ] 3.17 sec.
2026-07-15 22:03:18 00432_aggregate_function_scalars_and_constants: [ OK ] 3.27 sec.
2026-07-15 22:03:18 02681_undrop_query_uuid: [ OK ] 11.08 sec.
2026-07-15 22:03:19 02560_analyzer_materialized_view: [ OK ] 2.47 sec.
2026-07-15 22:03:19 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 1.30 sec.
2026-07-15 22:03:20 03203_system_numbers_limit_and_offset_complex: [ OK ] 1.30 sec.
2026-07-15 22:03:21 00041_aggregation_remap: [ OK ] 1.09 sec.
2026-07-15 22:03:21 02515_projections_with_totals: [ OK ] 1.11 sec.
2026-07-15 22:03:22 02931_file_cluster: [ OK ] 3.12 sec.
2026-07-15 22:03:22 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 8.67 sec.
2026-07-15 22:03:22 01139_asof_join_types: [ OK ] 1.70 sec.
2026-07-15 22:03:23 02360_send_logs_level_colors: [ OK ] 4.23 sec.
2026-07-15 22:03:23 00080_show_tables_and_system_tables: [ OK ] 1.40 sec.
2026-07-15 22:03:25 00506_shard_global_in_union: [ OK ] 2.26 sec.
2026-07-15 22:03:25 00502_sum_map: [ OK ] 2.56 sec.
2026-07-15 22:03:26 03165_order_by_duplicate: [ OK ] 1.01 sec.
2026-07-15 22:03:28 01328_bad_peephole_optimization: [ OK ] 1.45 sec.
2026-07-15 22:03:28 01430_modify_sample_by_zookeeper_long: [ OK ] 5.32 sec.
2026-07-15 22:03:30 03144_asof_join_ddb_doubles: [ OK ] 1.55 sec.
2026-07-15 22:03:32 02911_arrow_large_list: [ OK ] 2.51 sec.
2026-07-15 22:03:35 02872_null_as_default_nested: [ OK ] 13.52 sec.
2026-07-15 22:03:36 03006_join_on_inequal_expression_2: [ OK ] 11.81 sec.
2026-07-15 22:03:38 02100_multiple_hosts_command_line_set_ssl: [ OK ] 35.45 sec.
2026-07-15 22:03:42 02531_two_level_aggregation_bug: [ OK ] 14.23 sec.
2026-07-15 22:03:44 00098_shard_i_union_all: [ OK ] 8.41 sec.
2026-07-15 22:03:45 01699_timezoneOffset: [ OK ] 8.53 sec.
2026-07-15 22:03:47 02052_last_granula_adjust_logical_error: [ OK ] 8.70 sec.
2026-07-15 22:03:48 02458_insert_select_progress_tcp: [ OK ] 6.12 sec.
2026-07-15 22:03:49 01098_msgpack_format: [ OK ] 49.64 sec.
2026-07-15 22:03:51 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 64.11 sec.
2026-07-15 22:03:52 03150_dynamic_type_mv_insert: [ OK ] 6.21 sec.
2026-07-15 22:03:52 02458_datediff_date32: [ OK ] 8.39 sec.
2026-07-15 22:03:53 00431_if_nulls: [ OK ] 20.06 sec.
2026-07-15 22:03:53 00753_distributed_system_columns_and_system_tables: [ OK ] 2.97 sec.
2026-07-15 22:03:53 02503_in_lc_const_args_bug: [ OK ] 1.14 sec.
2026-07-15 22:03:54 02043_user_defined_executable_function_implicit_cast: [ OK ] 1.40 sec.
2026-07-15 22:03:55 00616_final_single_part: [ OK ] 3.65 sec.
2026-07-15 22:03:55 02433_default_expression_operator_in: [ OK ] 2.78 sec.
2026-07-15 22:03:56 00100_subquery_table_identifier: [ OK ] 6.78 sec.
2026-07-15 22:04:04 02880_indexHint__partition_id: [ OK ] 7.43 sec.
2026-07-15 22:04:07 01323_redundant_functions_in_order_by: [ OK ] 13.28 sec.
2026-07-15 22:04:07
2026-07-15 22:04:07 404 tests passed. 4 tests skipped. 2524.60 s elapsed (Process-10).
2026-07-15 22:04:08 03205_json_syntax: [ OK ] 12.56 sec.
2026-07-15 22:04:08
2026-07-15 22:04:08 Having 1 errors! 354 tests passed. 7 tests skipped. 2525.99 s elapsed (Process-8).
2026-07-15 22:04:10 00515_enhanced_time_zones: [ OK ] 14.69 sec.
2026-07-15 22:04:10
2026-07-15 22:04:10 442 tests passed. 8 tests skipped. 2527.93 s elapsed (Process-3).
2026-07-15 22:04:27 02461_cancel_finish_race: [ OK ] 32.34 sec.
2026-07-15 22:04:27
2026-07-15 22:04:27 Having 1 errors! 392 tests passed. 2 tests skipped. 2544.67 s elapsed (Process-7).
2026-07-15 22:04:36 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 73.16 sec.
2026-07-15 22:04:36
2026-07-15 22:04:36 488 tests passed. 13 tests skipped. 2554.15 s elapsed (Process-4).
2026-07-15 22:04:38 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 45.10 sec.
2026-07-15 22:04:38
2026-07-15 22:04:38 386 tests passed. 7 tests skipped. 2556.02 s elapsed (Process-5).
2026-07-15 22:04:41 02496_remove_redundant_sorting_analyzer: [ OK ] 53.81 sec.
2026-07-15 22:04:41
2026-07-15 22:04:41 387 tests passed. 3 tests skipped. 2559.19 s elapsed (Process-9).
2026-07-15 22:04:52 01655_plan_optimizations: [ OK ] 47.00 sec.
2026-07-15 22:04:52
2026-07-15 22:04:52 354 tests passed. 1 tests skipped. 2569.89 s elapsed (Process-6).
2026-07-15 22:04:58 Running 282 stateless tests (MainProcess).
2026-07-15 22:05:10 03231_restore_user_with_existing_role: [ OK ] 11.30 sec.
2026-07-15 22:05:16 03206_replication_lag_metric: [ OK ] 6.17 sec.
2026-07-15 22:05:17 03198_table_function_directory_path: [ OK ] 1.40 sec.
2026-07-15 22:05:20 03198_dynamic_read_subcolumns: [ OK ] 2.40 sec.
2026-07-15 22:05:21 03168_loop_engine_with_parallel_replicas: [ OK ] 0.96 sec.
2026-07-15 22:05:26 03154_lazy_token_iterator: [ OK ] 5.12 sec.
2026-07-15 22:05:57 03151_unload_index_race: [ OK ] 31.17 sec.
2026-07-15 22:05:57 03147_system_columns_access_checks: [ SKIPPED ] 0.00 sec.
2026-07-15 22:05:57 Reason: not running for current build
2026-07-15 22:06:00 03147_parquet_memory_tracking: [ OK ] 2.20 sec.
2026-07-15 22:06:01 03147_table_function_loop: [ OK ] 1.04 sec.
2026-07-15 22:09:42 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 221.45 sec.
2026-07-15 22:09:56 03008_s3_plain_rewritable_fault: [ OK ] 13.78 sec.
2026-07-15 22:12:58 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 182.23 sec.
2026-07-15 22:15:35 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 156.96 sec.
2026-07-15 22:19:14 03008_deduplication_insert_several_blocks_replicated: [ OK ] 218.94 sec.
2026-07-15 22:19:28 03002_part_log_rmt_fetch_merge_error: [ OK ] 13.06 sec.
2026-07-15 22:19:42 03002_part_log_rmt_fetch_mutate_error: [ OK ] 14.46 sec.
2026-07-15 22:19:44 02990_rmt_replica_path_uuid: [ OK ] 1.62 sec.
2026-07-15 22:20:01 02980_dist_insert_readonly_replica: [ OK ] 17.44 sec.
2026-07-15 22:20:08 02973_backup_of_in_memory_compressed: [ OK ] 6.90 sec.
2026-07-15 22:21:25 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 76.29 sec.
2026-07-15 22:21:27 02961_drop_tables: [ OK ] 2.00 sec.
2026-07-15 22:21:28 02960_partition_by_udf: [ OK ] 1.25 sec.
2026-07-15 22:21:43 02944_dynamically_change_filesystem_cache_size: [ OK ] 14.40 sec.
2026-07-15 22:21:58 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 14.23 sec.
2026-07-15 22:22:00 02931_max_num_to_warn: [ OK ] 2.81 sec.
2026-07-15 22:22:08 02916_move_partition_inactive_replica: [ OK ] 7.29 sec.
2026-07-15 22:22:15 02915_move_partition_inactive_replica: [ OK ] 6.84 sec.
2026-07-15 22:22:16 02911_row_policy_on_cluster: [ OK ] 1.61 sec.
2026-07-15 22:22:17 02910_prefetch_unexpceted_exception: [ OK ] 0.90 sec.
2026-07-15 22:22:18 02908_empty_named_collection: [ OK ] 0.94 sec.
2026-07-15 22:22:18 02908_many_requests_to_system_replicas: [ SKIPPED ] 0.00 sec.
2026-07-15 22:22:18 Reason: not running for current build
2026-07-15 22:22:30 02888_replicated_merge_tree_creation: [ OK ] 11.41 sec.
2026-07-15 22:22:32 02887_insert_quorum_wo_keeper_retries: [ OK ] 1.80 sec.
2026-07-15 22:22:37 02884_async_insert_skip_settings: [ OK ] 5.13 sec.
2026-07-15 22:22:46 02884_async_insert_native_protocol_3: [ OK ] 8.73 sec.
2026-07-15 22:22:46 02874_parquet_multiple_batches_array_inconsistent_offsets: [ SKIPPED ] 0.00 sec.
2026-07-15 22:22:46 Reason: not running for current build
2026-07-15 22:23:22 02871_peak_threads_usage: [ OK ] 36.10 sec.
2026-07-15 22:23:23 02867_create_user_ssh: [ OK ] 0.90 sec.
2026-07-15 22:23:25 02863_delayed_source_with_totals_and_extremes: [ OK ] 2.05 sec.
2026-07-15 22:23:41 02845_threads_count_in_distributed_queries: [ OK ] 15.71 sec.
2026-07-15 22:23:44 02843_insertion_table_schema_infer: [ OK ] 2.81 sec.
2026-07-15 22:24:06 02841_parquet_filter_pushdown: [ OK ] 22.42 sec.
2026-07-15 22:24:08 02833_multiprewhere_extra_column: [ OK ] 1.45 sec.
2026-07-15 22:24:20 02808_filesystem_cache_drop_query: [ OK ] 12.06 sec.
2026-07-15 22:24:29 02796_calculate_text_stack_trace: [ OK ] 9.05 sec.
2026-07-15 22:24:41 02789_filesystem_cache_alignment: [ OK ] 11.62 sec.
2026-07-15 22:24:45 02789_table_functions_errors: [ OK ] 4.33 sec.
2026-07-15 22:24:45 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec.
2026-07-15 22:24:45 Reason: not running for current build
2026-07-15 22:24:48 02775_show_columns_called_from_mysql: [ OK ] 3.21 sec.
2026-07-15 22:24:49 02762_replicated_database_no_args: [ OK ] 0.80 sec.
2026-07-15 22:24:54 02751_ip_types_aggregate_functions_states: [ OK ] 4.31 sec.
2026-07-15 22:24:58 02736_reading_and_writing_structure_fields: [ OK ] 4.71 sec.
2026-07-15 22:25:01 02735_capnp_case_insensitive_names_matching: [ OK ] 2.66 sec.
2026-07-15 22:25:49 02735_parquet_encoder: [ OK ] 47.92 sec.
2026-07-15 22:25:50 02725_url_support_virtual_column: [ OK ] 1.35 sec.
2026-07-15 22:26:30 02725_start_stop_fetches: [ OK ] 39.22 sec.
2026-07-15 22:26:31 02710_default_replicated_parameters: [ OK ] 1.11 sec.
2026-07-15 22:26:35 02706_show_columns: [ OK ] 3.72 sec.
2026-07-15 22:26:46 02700_s3_part_INT_MAX: [ FAIL ] 11.45 sec.
2026-07-15 22:26:46 Reason: return code: 241
2026-07-15 22:26:46 [a08ac3a42dd2] 2026.07.15 19:26:45.977474 [ 140921 ] {9efd313b-955b-4571-b02c-e7175aa3ec50} executeQuery: Code: 241. DB::Exception: Memory limit (total) exceeded: would use 27.73 GiB (attempt to allocate chunk of 2147483711 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker. (MEMORY_LIMIT_EXCEEDED) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:55940) (comment: 02700_s3_part_INT_MAX.sh) (in query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_2hirxbqy/test_INT_MAX.tsv', '', '[HIDDEN]', 'TSV') SETTINGS s3_max_single_part_upload_size = '5Gi' SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024) SETTINGS s3_max_single_part_upload_size = '5Gi'), Stack trace (when copying this message, always include the lines below):
2026-07-15 22:26:46
2026-07-15 22:26:46 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000343c5254
2026-07-15 22:26:46 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb62c9
2026-07-15 22:26:46 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa94445
2026-07-15 22:26:46 3. ./src/Common/LoggingFormatStringHelpers.h:45: DB::Exception::Exception>>(int, FormatStringHelperImpl::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity::type, std::type_identity>>::type>, char const*&&, char const*&&, String&&, long&, String&&, char const*&&, std::basic_string_view>&&) @ 0x000000001ae026bd
2026-07-15 22:26:46 4. ./build_docker/./src/Common/MemoryTracker.cpp:343: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001ae00e3f
2026-07-15 22:26:46 5. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001ae007d7
2026-07-15 22:26:46 6. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001ae007d7
2026-07-15 22:26:46 7. ./build_docker/./src/Common/MemoryTracker.cpp:0: MemoryTracker::allocImpl(long, bool, MemoryTracker*, double) @ 0x000000001ae007d7
2026-07-15 22:26:46 8. ./build_docker/./src/Common/CurrentMemoryTracker.cpp:59: CurrentMemoryTracker::alloc(long) @ 0x000000001ad3889d
2026-07-15 22:26:46 9. ./build_docker/./src/Common/Allocator.cpp:0: Allocator::realloc(void*, unsigned long, unsigned long, unsigned long) @ 0x000000001ad353ff
2026-07-15 22:26:46 10. ./src/IO/BufferWithOwnMemory.h:101: DB::Memory>::resize(unsigned long) @ 0x000000001aef8082
2026-07-15 22:26:46 11. ./src/IO/BufferWithOwnMemory.h:80: DB::WriteBufferFromS3::reallocateFirstBuffer() @ 0x0000000026b39d2e
2026-07-15 22:26:46 12. ./src/IO/BufferBase.h:41: DB::WriteBufferFromS3::nextImpl() @ 0x0000000026b3934b
2026-07-15 22:26:46 13. DB::WriteBuffer::write(char const*, unsigned long) @ 0x000000000aad3e3b
2026-07-15 22:26:46 14. ./build_docker/./src/Processors/Formats/Impl/ParallelFormattingOutputFormat.cpp:0: DB::ParallelFormattingOutputFormat::collectorThreadFunction(std::shared_ptr const&) @ 0x000000002d75f46a
2026-07-15 22:26:46 15. ./src/Common/ThreadPool.h:312: ThreadFromGlobalPoolImpl::ThreadFromGlobalPoolImpl(DB::ParallelFormattingOutputFormat::ParallelFormattingOutputFormat(DB::ParallelFormattingOutputFormat::Params)::'lambda'()&&)::'lambda'()::operator()() @ 0x000000002d287c0b
2026-07-15 22:26:46 16. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001af7fcb2
2026-07-15 22:26:46 17. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000001af8c0b5
2026-07-15 22:26:46 18. asan_thread_start(void*) @ 0x000000000aa49059
2026-07-15 22:26:46 19. ? @ 0x00007fe94022bac3
2026-07-15 22:26:46 20. ? @ 0x00007fe9402bd8d0
2026-07-15 22:26:46
2026-07-15 22:26:46 [a08ac3a42dd2] 2026.07.15 19:26:45.979158 [ 140921 ] {9efd313b-955b-4571-b02c-e7175aa3ec50} WriteBufferFromS3: Nothing to abort. Details: bucket test, key test_2hirxbqy/test_INT_MAX.tsv, total size 0, count 1073741824, hidden_size 1073741824, offset 0, with pool: true, prefinalized false, finalized false
2026-07-15 22:26:46 Received exception from server (version 24.8.14):
2026-07-15 22:26:46 Code: 241. DB::Exception: Received from localhost:9000. DB::Exception: Memory limit (total) exceeded: would use 27.73 GiB (attempt to allocate chunk of 2147483711 bytes), maximum: 27.54 GiB. OvercommitTracker decision: Query was selected to stop by OvercommitTracker.. (MEMORY_LIMIT_EXCEEDED)
2026-07-15 22:26:46 (query: INSERT INTO FUNCTION s3('http://localhost:11111/test/test_2hirxbqy/test_INT_MAX.tsv', '', '', 'TSV')
2026-07-15 22:26:46 SELECT repeat('a', 1024) FROM numbers((pow(2, 30) * 2) / 1024)
2026-07-15 22:26:46 SETTINGS s3_max_single_part_upload_size = '5Gi';)
2026-07-15 22:26:46 , result:
2026-07-15 22:26:46
2026-07-15 22:26:46
2026-07-15 22:26:46
2026-07-15 22:26:46 stdout:
2026-07-15 22:26:46
2026-07-15 22:26:46
2026-07-15 22:26:46 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 105430 --group_by_two_level_threshold_bytes 37952686 --distributed_aggregation_memory_efficient 1 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 12613004 --max_read_buffer_size 924265 --prefer_localhost_replica 1 --max_block_size 94386 --max_joined_block_size_rows 82644 --max_threads 1 --optimize_append_index 0 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 0 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 48 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 10442923 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method read --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 8Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 31 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2710739214 --min_compress_block_size 2902394 --max_compress_block_size 2462931 --merge_tree_compact_parts_min_granules_to_multibuffer_read 127 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 678227 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.4 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 0 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 1 --optimize_functions_to_subcolumns 1 --parallel_replicas_local_plan 1
2026-07-15 22:26:46
2026-07-15 22:26:46 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 433940 --vertical_merge_algorithm_min_columns_to_activate 49 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1814096604 --index_granularity_bytes 30131613 --merge_max_block_size 10423 --index_granularity 6358 --min_bytes_for_wide_part 0 --marks_compress_block_size 31059 --primary_key_compress_block_size 48606 --replace_long_file_name_to_hash 0 --max_file_name_length 0 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 358700081 --compact_parts_max_granules_to_buffer 178 --compact_parts_merge_max_bytes_to_prefetch_part 4026915 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 10
2026-07-15 22:26:46
2026-07-15 22:26:46 Database: test_2hirxbqy
2026-07-15 22:26:46 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec.
2026-07-15 22:26:46 Reason: not running for current build
2026-07-15 22:26:56 02572_system_logs_materialized_views_ignore_errors: [ OK ] 9.46 sec.
2026-07-15 22:27:06 02566_ipv4_ipv6_binary_formats: [ OK ] 10.20 sec.
2026-07-15 22:27:09 02561_temporary_table_sessions: [ OK ] 2.76 sec.
2026-07-15 22:27:12 02541_arrow_duration_type: [ OK ] 3.28 sec.
2026-07-15 22:28:01 02535_max_parallel_replicas_custom_key_mt: [ OK ] 48.48 sec.
2026-07-15 22:28:55 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 53.78 sec.
2026-07-15 22:28:59 02522_avro_complicate_schema: [ OK ] 3.62 sec.
2026-07-15 22:30:25 02515_cleanup_async_insert_block_ids: [ OK ] 86.35 sec.
2026-07-15 22:30:28 02510_orc_map_indexes: [ OK ] 2.99 sec.
2026-07-15 22:30:35 02503_cache_on_write_with_small_segment_size: [ OK ] 7.21 sec.
2026-07-15 22:30:44 02503_insert_storage_snapshot: [ OK ] 8.55 sec.
2026-07-15 22:30:48 02501_deep_recusion_schema_inference: [ OK ] 3.78 sec.
2026-07-15 22:30:48 02497_trace_events_stress_long: [ SKIPPED ] 0.00 sec.
2026-07-15 22:30:48 Reason: not running for current build
2026-07-15 22:30:50 02495_s3_filter_by_file: [ OK ] 2.08 sec.
2026-07-15 22:30:52 02494_query_cache_user_quotas_after_drop: [ OK ] 1.67 sec.
2026-07-15 22:31:04 02494_query_cache_query_log: [ OK ] 12.50 sec.
2026-07-15 22:31:07 02494_query_cache_case_agnostic_matching: [ OK ] 2.97 sec.
2026-07-15 22:31:09 02494_query_cache_compression: [ OK ] 1.55 sec.
2026-07-15 22:31:11 02494_query_cache_totals_extremes: [ OK ] 1.91 sec.
2026-07-15 22:31:12 02494_query_cache_exception_handling: [ OK ] 1.05 sec.
2026-07-15 22:31:14 02494_query_cache_eligible_queries: [ OK ] 2.13 sec.
2026-07-15 22:31:22 02494_query_cache_ttl_long: [ OK ] 7.32 sec.
2026-07-15 22:31:25 02494_query_cache_events: [ OK ] 3.53 sec.
2026-07-15 22:31:37 02494_trace_log_profile_events: [ OK ] 12.05 sec.
2026-07-15 22:31:39 02494_query_cache_bugs: [ OK ] 1.45 sec.
2026-07-15 22:31:41 02494_query_cache_squash_partial_results: [ OK ] 2.22 sec.
2026-07-15 22:31:43 02484_substitute_udf_storage_args: [ OK ] 1.63 sec.
2026-07-15 22:31:44 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 1.10 sec.
2026-07-15 22:31:49 02483_capnp_decimals: [ OK ] 4.99 sec.
2026-07-15 22:31:52 02482_new_json_nested_arrays_with_same_keys: [ OK ] 3.12 sec.
2026-07-15 22:31:55 02482_json_nested_arrays_with_same_keys: [ OK ] 3.02 sec.
2026-07-15 22:32:00 02481_custom_separated_and_template_with_csv_field: [ OK ] 4.88 sec.
2026-07-15 22:32:06 02459_glob_for_recursive_directory_traversal: [ OK ] 6.05 sec.
2026-07-15 22:32:09 02458_hdfs_cluster_schema_inference: [ OK ] 2.12 sec.
2026-07-15 22:32:14 02440_mutations_finalization: [ OK ] 4.65 sec.
2026-07-15 22:32:15 02422_msgpack_uuid_wrong_column: [ OK ] 1.00 sec.
2026-07-15 22:32:15 02422_allow_implicit_no_password: [ SKIPPED ] 0.00 sec.
2026-07-15 22:32:15 Reason: not running for current build
2026-07-15 22:32:27 02421_record_errors_row_by_input_format: [ OK ] 11.97 sec.
2026-07-15 22:32:28 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 1.00 sec.
2026-07-15 22:32:31 02404_schema_inference_cache_respect_format_settings: [ OK ] 3.39 sec.
2026-07-15 22:32:31 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec.
2026-07-15 22:32:31 Reason: disabled
2026-07-15 22:32:31 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec.
2026-07-15 22:32:31 Reason: disabled
2026-07-15 22:32:33 02391_recursive_buffer: [ OK ] 1.40 sec.
2026-07-15 22:32:35 02385_profile_events_overflow: [ OK ] 1.71 sec.
2026-07-15 22:32:36 02376_arrow_dict_with_string: [ OK ] 0.91 sec.
2026-07-15 22:32:39 02373_heap_buffer_overflow_in_avro: [ OK ] 3.22 sec.
2026-07-15 22:33:04 02352_rwlock: [ OK ] 25.47 sec.
2026-07-15 22:33:08 02350_views_max_insert_threads: [ OK ] 3.22 sec.
2026-07-15 22:33:09 02346_additional_filters_distr: [ OK ] 1.35 sec.
2026-07-15 22:33:14 02337_drop_filesystem_cache_access: [ OK ] 5.13 sec.
2026-07-15 22:33:16 02323_null_modifier_in_table_function: [ OK ] 1.05 sec.
2026-07-15 22:33:17 02313_avro_records_and_maps: [ OK ] 1.66 sec.
2026-07-15 22:33:21 02311_system_zookeeper_insert_priv: [ OK ] 3.41 sec.
2026-07-15 22:33:22 02304_orc_arrow_parquet_string_as_string: [ OK ] 1.05 sec.
2026-07-15 22:33:37 02294_overcommit_overflow: [ OK ] 15.36 sec.
2026-07-15 22:34:53 02286_mysql_dump_input_format: [ OK ] 75.31 sec.
2026-07-15 22:35:01 02262_column_ttl: [ OK ] 8.52 sec.
2026-07-15 22:35:27 02247_written_bytes_quota: [ OK ] 25.61 sec.
2026-07-15 22:35:28 02244_lowcardinality_hash_join: [ OK ] 1.22 sec.
127.0.0.1 - - [16/Jul/2026:02:35:50 +0000] "PUT /devstoreaccount1/cont/eqblnifmpzveqdryrjrweqxfhczgqrkt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:50 +0000] "PUT /devstoreaccount1/cont/bvahkcaqopjhmwqfzrssfwbgtofbzhzp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:50 +0000] "PUT /devstoreaccount1/cont/prhfaahhukfulsgkxvulpyvpkxsqaqvd HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/uxjnrsapddwhkqzxbxolmvncsrxwerkc HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/cbkqzixrdtkreqdfasejsccoembowbzp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/xjnfheuknalqgscfbdmpheiixkaeelkv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/fcuxmmlqxxathzzcjwbmbpcmfcpgjisl HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/kgznmxbxxivqcmzllghciqosohtjetdg HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/xqsqfgfwwczukqrbnbwkcvkwtsngexov HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "PUT /devstoreaccount1/cont/yjakfekgvvahdzdsnsvkqcixdnsfaiuw HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "GET /devstoreaccount1/cont/prhfaahhukfulsgkxvulpyvpkxsqaqvd HTTP/1.1" 206 520
127.0.0.1 - - [16/Jul/2026:02:35:51 +0000] "GET /devstoreaccount1/cont/bvahkcaqopjhmwqfzrssfwbgtofbzhzp HTTP/1.1" 206 808111
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/yjakfekgvvahdzdsnsvkqcixdnsfaiuw HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/fcuxmmlqxxathzzcjwbmbpcmfcpgjisl HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/cbkqzixrdtkreqdfasejsccoembowbzp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/bvahkcaqopjhmwqfzrssfwbgtofbzhzp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/prhfaahhukfulsgkxvulpyvpkxsqaqvd HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/uxjnrsapddwhkqzxbxolmvncsrxwerkc HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/xjnfheuknalqgscfbdmpheiixkaeelkv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/xqsqfgfwwczukqrbnbwkcvkwtsngexov HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/kgznmxbxxivqcmzllghciqosohtjetdg HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:35:59 +0000] "DELETE /devstoreaccount1/cont/eqblnifmpzveqdryrjrweqxfhczgqrkt HTTP/1.1" 202 -
2026-07-15 22:35:59 02242_system_filesystem_cache_log_table: [ OK ] 30.34 sec.
2026-07-15 22:36:13 02242_delete_user_race: [ OK ] 14.66 sec.
127.0.0.1 - - [16/Jul/2026:02:37:02 +0000] "PUT /devstoreaccount1/cont/fbkfwlxqtbxdbkflvdnqbavtorgmvcbh HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/jipkvhoatpqneipukquhyafyucegqgun HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/exvswzzdnfjedtjrjjxkxhzahraiyjcd HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/jetyspsqjmufcyngwopgqomaplbakdco HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/jtmdbymjhdmgyvaciyynnfppaykdwxxe HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/liarlobqjscdovdrwiaphvfflwhsqmpg HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/upnbluxhnjykiwommpnyshnjuqvjwzde HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/vxprnscyuoliwrryuqmopjwgpinnsavj HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:05 +0000] "PUT /devstoreaccount1/cont/esvkfeasnxlrepilzediswmxxqhyslzx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/ulaplwscikjffrouqibdlpgeojgunldz HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/wbityleqfstwzlreiwfmmgyyngqcvazr HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/ndhbovykpvgkiwktelfrfvusuhungawv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/jclpfibwmpbqlfaxccvsuwrvkyictgnb HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/fdfltfenwejnwpcrzvqhujxgrjlsomgb HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/pwudypjbeufyxfafthgvbetvpjnhcacx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/vdvqsgydwfxxgnwknwxjjrycxpwxcvhk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:10 +0000] "PUT /devstoreaccount1/cont/btmymkcwzhnjylksxgbbzedqlhvvzmcg HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/kmxysvnnpbjhbkhigisaqsumqgehpwff HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/zdijrlvwnxxcnspvjbrzjiiuncthjrrd HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/vqfnsxddgqfagvcjqipccwxaqzgpqlfs HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/lgnrqyadxwytjtbinwjuuqpqbwqmvnwc HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/gypsycbchnivhvvpijxjwpezvljfjrsq HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/eigbohadezypwmejmbthdsumvvwjhgvn HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/dtodzwpbbixdkohegeymunntdymgklsv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:13 +0000] "PUT /devstoreaccount1/cont/xsyxfmbqaajggwsuxmavvnkjyarlxsoe HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/pmjsmoipymoejhbjmmjitbgmpqhamowp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/gpgysalgotuzbonbvolypxspsmqkrqll HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/bnvqfhqcolxnzdvtcwitybumkqghcptd HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/rrnysbugthpejndonukcjuoegcxtqqck HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/cmknorgirwsnjhiwjqqschusxdxkbcjb HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/kcaidkggjiektvqdxizynmijbtkdowcf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/tiqwiepveozzqccsuprfltoxsprktgjq HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:15 +0000] "PUT /devstoreaccount1/cont/nkovzkqacmoqjohtmekckeqlmyjitfbx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/jqtejvhacfmhbirlibviajcqatzilmuh HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/oaiaasxxjuacqhrtnsvbvadgfsailmrt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/czvjunuaapehhgnirbxojjbufuhhosmg HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/dvtvsvwxdmmrerjuwbiahhrxtjwyaerd HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/zhpfozjprsfxcbuioexxbwoxksgupxgx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/dyiafennvdijeuhapduxqyxtgsgebdqp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/wluembtkzhjztpcersocyvihmsuzqpdk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:16 +0000] "PUT /devstoreaccount1/cont/lxnunrzobuxipzstfwuufomcystxpsad HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "GET /devstoreaccount1/cont/zdijrlvwnxxcnspvjbrzjiiuncthjrrd HTTP/1.1" 206 80
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "GET /devstoreaccount1/cont/jipkvhoatpqneipukquhyafyucegqgun HTTP/1.1" 206 746
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "GET /devstoreaccount1/cont/kmxysvnnpbjhbkhigisaqsumqgehpwff HTTP/1.1" 206 746
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/wgowwowgqpngkjdgmkfpbdwaqrfxubhs HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/tyzptelnebtllnbqpllvuytmnbrwombr HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/bxjondyjezzqjhuykdlsigmqwdrjqwql HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/uagotjovhxjmsrmvzzjdnjhikrsoxati HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/bbhrqredxwuuqcsperrnjntwxmnalvht HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/encekvspklwlfcqwnnrhldtkychykklt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/odlaxaqcgalvlbtiubbycwwymwdevlan HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:17 +0000] "PUT /devstoreaccount1/cont/ifnqmpohnwrzsnwshbbhtntnnaljpiza HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/xrawqaqovwvjkjdtsgjbuzkchmmhdgrr HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/vsmmyesrfgddkbxzgewrejvwunlcabqv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/cgqstqdynqpkpcrewlwgywncxciyjoqt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/dbxnnljlumxtxjfohhixjyiifzddjyuq HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/lmvqngvdfboktykuydkkkikjsvxxfhms HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/migahobjpghnimaanoqtwanahuphzrmx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/mwbpgycdvnggxeaxmkemlercukrtknxy HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/xhlwlaepzstqtmofbppbfxcckqgypyjk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:18 +0000] "PUT /devstoreaccount1/cont/kpelmrbzcpskebecgdhslamwoilsprlv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/fsdlsthgfiypabzacqxwihjdkunyrzfp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/jftngntfraskwcztxjglzdvvgrmhohlb HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/kjnjxhbzentwlkjegcdvjnddghkgnnli HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/cnrrrqxocoulkbcgvzskpfwsedahyaso HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/lcduninmjbylvubdbvscdhidbcoqcvdh HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/dundasdchvntivcvaqmtvaikubohykwl HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/kagqtukhepvhffibyjyglxjzqbtiedkk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/qjtrznswqjddltenhkywgukpwvdihkgl HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/qabugkklktgmznlvvxmglfqdtjneswph HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:20 +0000] "PUT /devstoreaccount1/cont/yfpgfkqwlscnylgydfhilgfehimgnoow HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/fnexyhhsynbspokctpqmythvjvbdvbig HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/pkdnhoybkhpnqodjvloexveqouswesju HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/ooglqbhgbpakiecwwjbftdocxtoqctfm HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/oejdfuczarycqevrepqzepbuhapzbimz HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/wjqwtzpkpmugoawjtlhownhtanecrpaf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/arhjfwwquxgwvxszcfyixbksdnbkykdn HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/dwkvjudrfjhpbicygvtrvberznhmrxfa HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/vcsrwgxlonyszmvvdopszfvvpdaxgexx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/qzbpvjyopprtckvhdoyckkrcuyuqhfne HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/lufjhakvacqzpbnbnnlboytlkbnvjelf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/hciszpvrkqegkzxcojtdfexcpbrbwwyx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/cepmlpvhvenfhpooktwtumavjfmxuhha HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/dmjlbggauytpyktxifmjcmgohxeqqkia HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/lvbhrhazccwknaeecbtienugngjynfty HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:21 +0000] "PUT /devstoreaccount1/cont/cumozensxgrehywjedjoxgsmbjbrxwdv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/igcedyphpxviximyeldkplmrdhvqszko HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/gkajviizbrbskdnpicioadgytrhdasio HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/isbkomjxriuxuupjppepqrbbdtfwgztk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/zjqrujsqgrnpjngxmcxebuikfblpghqe HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/gmcyqldhkbjujtydszodkefkmbcntham HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/cybzcsbvvhfdljaqmgaqtjumnhpmbdzj HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/stqvnwmjetmtifapravmkqmjihuodjdk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/oyqlvotydzqegkatspfzznaujydeznta HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/sycijxastnbgzxxxkyjyjywfzessclon HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/agurorsdgsysvpwalwqgyufowbeggfqw HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/vlpjirevcdhufqepbewowwtaxhrygmxu HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/ybjoobmrgchwrvzdrfvsnnaupjfufytg HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/dtrijyyiivyyugjgcwowyosvxsbkevci HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/elmkgstyxepfrmuqahrldzdcplwkyvov HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:22 +0000] "PUT /devstoreaccount1/cont/xdppoxywfsjimrtpkefqknxmubqfaoew HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/heajwogjfudaprcvhvcptumclelafqgf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/yegqaqqkjprhwlnqecvlugjmrgvbvhfp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/fmbpcopxoymbyoqjkrswiqmqitptkbta HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/dfzcovglaxxsxxnfvtslznzzgivyeorm HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/auermrpokjzspbuezvvbskjivmcokstp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/hgaohcalepwkqxusfojcrudohjvvqvnf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/uxxvegwmxqvzztxjsdxgapepltfjiddy HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/uahmfeuobwxhrusnblwamuqiymqlzewk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/iohenszrqxrgzovdqvyegztdkdojzvzo HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:23 +0000] "PUT /devstoreaccount1/cont/rreyvgwgplxfvbudlvfqzrkctfsbaroh HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:28 +0000] "PUT /devstoreaccount1/cont/xsmkcsgvwiidshckohzryuwqrvrjpmbo HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:28 +0000] "PUT /devstoreaccount1/cont/gatkcsannxhgadtwufhewubsieivltph HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:28 +0000] "PUT /devstoreaccount1/cont/oqqifcexxwnurodaubvnmmksvydnuigi HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:29 +0000] "PUT /devstoreaccount1/cont/mquxoqorqhzcabydwutazvwcmlkjmhxo HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:29 +0000] "PUT /devstoreaccount1/cont/vqgvbslbagswlvununrpimawihnwqyrk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:29 +0000] "PUT /devstoreaccount1/cont/lzlsdqrnrblelatqcbkwdpiprryimvhc HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:29 +0000] "PUT /devstoreaccount1/cont/mopcqkuufheemwablrixwrdpyqoorsuo HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:30 +0000] "PUT /devstoreaccount1/cont/jowddihbyoxucgkkdnyfpfvvkkatghuu HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:30 +0000] "PUT /devstoreaccount1/cont/tbwevlaleilkcouivrjrcbyiqaupmfhu HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:30 +0000] "PUT /devstoreaccount1/cont/xxdqtqtgzwopynvghpvwkudaohtxbvcn HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/esvkfeasnxlrepilzediswmxxqhyslzx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/liarlobqjscdovdrwiaphvfflwhsqmpg HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jtmdbymjhdmgyvaciyynnfppaykdwxxe HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jipkvhoatpqneipukquhyafyucegqgun HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/exvswzzdnfjedtjrjjxkxhzahraiyjcd HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jetyspsqjmufcyngwopgqomaplbakdco HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vxprnscyuoliwrryuqmopjwgpinnsavj HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/upnbluxhnjykiwommpnyshnjuqvjwzde HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/ifnqmpohnwrzsnwshbbhtntnnaljpiza HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/bbhrqredxwuuqcsperrnjntwxmnalvht HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/uagotjovhxjmsrmvzzjdnjhikrsoxati HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/wgowwowgqpngkjdgmkfpbdwaqrfxubhs HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/tyzptelnebtllnbqpllvuytmnbrwombr HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/bxjondyjezzqjhuykdlsigmqwdrjqwql HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/odlaxaqcgalvlbtiubbycwwymwdevlan HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/encekvspklwlfcqwnnrhldtkychykklt HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/kpelmrbzcpskebecgdhslamwoilsprlv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/migahobjpghnimaanoqtwanahuphzrmx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lmvqngvdfboktykuydkkkikjsvxxfhms HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vsmmyesrfgddkbxzgewrejvwunlcabqv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cgqstqdynqpkpcrewlwgywncxciyjoqt HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dbxnnljlumxtxjfohhixjyiifzddjyuq HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xhlwlaepzstqtmofbppbfxcckqgypyjk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/mwbpgycdvnggxeaxmkemlercukrtknxy HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xxdqtqtgzwopynvghpvwkudaohtxbvcn HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xsmkcsgvwiidshckohzryuwqrvrjpmbo HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lzlsdqrnrblelatqcbkwdpiprryimvhc HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/gatkcsannxhgadtwufhewubsieivltph HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/mopcqkuufheemwablrixwrdpyqoorsuo HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vqgvbslbagswlvununrpimawihnwqyrk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/oqqifcexxwnurodaubvnmmksvydnuigi HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/mquxoqorqhzcabydwutazvwcmlkjmhxo HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/tbwevlaleilkcouivrjrcbyiqaupmfhu HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jowddihbyoxucgkkdnyfpfvvkkatghuu HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/btmymkcwzhnjylksxgbbzedqlhvvzmcg HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/fdfltfenwejnwpcrzvqhujxgrjlsomgb HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jclpfibwmpbqlfaxccvsuwrvkyictgnb HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/ulaplwscikjffrouqibdlpgeojgunldz HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/wbityleqfstwzlreiwfmmgyyngqcvazr HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/ndhbovykpvgkiwktelfrfvusuhungawv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vdvqsgydwfxxgnwknwxjjrycxpwxcvhk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/pwudypjbeufyxfafthgvbetvpjnhcacx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xsyxfmbqaajggwsuxmavvnkjyarlxsoe HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/gypsycbchnivhvvpijxjwpezvljfjrsq HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lgnrqyadxwytjtbinwjuuqpqbwqmvnwc HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/kmxysvnnpbjhbkhigisaqsumqgehpwff HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/zdijrlvwnxxcnspvjbrzjiiuncthjrrd HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vqfnsxddgqfagvcjqipccwxaqzgpqlfs HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dtodzwpbbixdkohegeymunntdymgklsv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/eigbohadezypwmejmbthdsumvvwjhgvn HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/nkovzkqacmoqjohtmekckeqlmyjitfbx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cmknorgirwsnjhiwjqqschusxdxkbcjb HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/rrnysbugthpejndonukcjuoegcxtqqck HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/pmjsmoipymoejhbjmmjitbgmpqhamowp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/gpgysalgotuzbonbvolypxspsmqkrqll HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/bnvqfhqcolxnzdvtcwitybumkqghcptd HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/tiqwiepveozzqccsuprfltoxsprktgjq HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/kcaidkggjiektvqdxizynmijbtkdowcf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lxnunrzobuxipzstfwuufomcystxpsad HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/zhpfozjprsfxcbuioexxbwoxksgupxgx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dvtvsvwxdmmrerjuwbiahhrxtjwyaerd HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jqtejvhacfmhbirlibviajcqatzilmuh HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/oaiaasxxjuacqhrtnsvbvadgfsailmrt HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/czvjunuaapehhgnirbxojjbufuhhosmg HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/wluembtkzhjztpcersocyvihmsuzqpdk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dyiafennvdijeuhapduxqyxtgsgebdqp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/yfpgfkqwlscnylgydfhilgfehimgnoow HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/fsdlsthgfiypabzacqxwihjdkunyrzfp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dundasdchvntivcvaqmtvaikubohykwl HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/jftngntfraskwcztxjglzdvvgrmhohlb HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/kagqtukhepvhffibyjyglxjzqbtiedkk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lcduninmjbylvubdbvscdhidbcoqcvdh HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/kjnjxhbzentwlkjegcdvjnddghkgnnli HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cnrrrqxocoulkbcgvzskpfwsedahyaso HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/qabugkklktgmznlvvxmglfqdtjneswph HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/qjtrznswqjddltenhkywgukpwvdihkgl HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lufjhakvacqzpbnbnnlboytlkbnvjelf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/fnexyhhsynbspokctpqmythvjvbdvbig HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/arhjfwwquxgwvxszcfyixbksdnbkykdn HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/pkdnhoybkhpnqodjvloexveqouswesju HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dwkvjudrfjhpbicygvtrvberznhmrxfa HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/wjqwtzpkpmugoawjtlhownhtanecrpaf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/ooglqbhgbpakiecwwjbftdocxtoqctfm HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/oejdfuczarycqevrepqzepbuhapzbimz HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/qzbpvjyopprtckvhdoyckkrcuyuqhfne HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vcsrwgxlonyszmvvdopszfvvpdaxgexx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/gmcyqldhkbjujtydszodkefkmbcntham HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/hciszpvrkqegkzxcojtdfexcpbrbwwyx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/igcedyphpxviximyeldkplmrdhvqszko HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cepmlpvhvenfhpooktwtumavjfmxuhha HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/gkajviizbrbskdnpicioadgytrhdasio HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cumozensxgrehywjedjoxgsmbjbrxwdv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dmjlbggauytpyktxifmjcmgohxeqqkia HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/lvbhrhazccwknaeecbtienugngjynfty HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/zjqrujsqgrnpjngxmcxebuikfblpghqe HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/isbkomjxriuxuupjppepqrbbdtfwgztk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xdppoxywfsjimrtpkefqknxmubqfaoew HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/cybzcsbvvhfdljaqmgaqtjumnhpmbdzj HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/vlpjirevcdhufqepbewowwtaxhrygmxu HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/stqvnwmjetmtifapravmkqmjihuodjdk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/ybjoobmrgchwrvzdrfvsnnaupjfufytg HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/agurorsdgsysvpwalwqgyufowbeggfqw HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/oyqlvotydzqegkatspfzznaujydeznta HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/sycijxastnbgzxxxkyjyjywfzessclon HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/elmkgstyxepfrmuqahrldzdcplwkyvov HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dtrijyyiivyyugjgcwowyosvxsbkevci HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/rreyvgwgplxfvbudlvfqzrkctfsbaroh HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/heajwogjfudaprcvhvcptumclelafqgf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/hgaohcalepwkqxusfojcrudohjvvqvnf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/yegqaqqkjprhwlnqecvlugjmrgvbvhfp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/uxxvegwmxqvzztxjsdxgapepltfjiddy HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/auermrpokjzspbuezvvbskjivmcokstp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/fmbpcopxoymbyoqjkrswiqmqitptkbta HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/dfzcovglaxxsxxnfvtslznzzgivyeorm HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/iohenszrqxrgzovdqvyegztdkdojzvzo HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/uahmfeuobwxhrusnblwamuqiymqlzewk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/fbkfwlxqtbxdbkflvdnqbavtorgmvcbh HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:37:31 +0000] "DELETE /devstoreaccount1/cont/xrawqaqovwvjkjdtsgjbuzkchmmhdgrr HTTP/1.1" 202 -
2026-07-15 22:37:32 02241_filesystem_cache_on_write_operations: [ OK ] 77.02 sec.
2026-07-15 22:37:33 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 1.50 sec.
2026-07-15 22:37:35 02240_filesystem_query_cache: [ OK ] 1.26 sec.
127.0.0.1 - - [16/Jul/2026:02:37:56 +0000] "PUT /devstoreaccount1/cont/inqanmifljrjppoobvnenmvwlmcnssrm HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/qrjxcyzckxzuquwzmhbhvbigyixjulnc HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/tpyzstiednrynomarnqomxdmbwaanjwa HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/jddvookgybrfeudwdhamsdhcaczechrx HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/lqthebuzbiylihxdhchlizuzecbcxjhi HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/rhoevonhafsmosjbscwkdacjlxyqlcqk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/xytxpidwbxoygozfjmmkncwtuvuptpwe HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/vnsmlkwmcqvamrrhokvnxevehwfruvyu HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/nwexzrdjqngqalzczxxirycxkshrphoj HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:57 +0000] "PUT /devstoreaccount1/cont/veibmfarryjrwxyqdpcqtdztbfgrlrqb HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:37:58 +0000] "GET /devstoreaccount1/cont/tpyzstiednrynomarnqomxdmbwaanjwa HTTP/1.1" 206 80
127.0.0.1 - - [16/Jul/2026:02:37:58 +0000] "GET /devstoreaccount1/cont/qrjxcyzckxzuquwzmhbhvbigyixjulnc HTTP/1.1" 206 746
127.0.0.1 - - [16/Jul/2026:02:38:01 +0000] "GET /devstoreaccount1/cont/tpyzstiednrynomarnqomxdmbwaanjwa HTTP/1.1" 206 80
127.0.0.1 - - [16/Jul/2026:02:38:01 +0000] "GET /devstoreaccount1/cont/qrjxcyzckxzuquwzmhbhvbigyixjulnc HTTP/1.1" 206 746
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/veibmfarryjrwxyqdpcqtdztbfgrlrqb HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/xytxpidwbxoygozfjmmkncwtuvuptpwe HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/lqthebuzbiylihxdhchlizuzecbcxjhi HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/qrjxcyzckxzuquwzmhbhvbigyixjulnc HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/tpyzstiednrynomarnqomxdmbwaanjwa HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/jddvookgybrfeudwdhamsdhcaczechrx HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/rhoevonhafsmosjbscwkdacjlxyqlcqk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/nwexzrdjqngqalzczxxirycxkshrphoj HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/vnsmlkwmcqvamrrhokvnxevehwfruvyu HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:03 +0000] "DELETE /devstoreaccount1/cont/inqanmifljrjppoobvnenmvwlmcnssrm HTTP/1.1" 202 -
2026-07-15 22:38:03 02240_system_filesystem_cache_table: [ OK ] 28.08 sec.
2026-07-15 22:38:03 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec.
2026-07-15 22:38:03 Reason: disabled
2026-07-15 22:38:08 02227_test_create_empty_sqlite_db: [ OK ] 4.95 sec.
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/tqajdfyoqvprlcpzmryofkfnvtonllwl HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/fbfhrqpwowdatjuaomfapnfzhpvdxjsf HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/mbqwgoxjgjrybyealolqmmtuiubmtyid HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/lyemyzfgwjzyxferzybeysysceiwkzlk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/njftthzsueeabnmichajaypwkmyqviuw HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/iuaffvmyvzbvoxzhnmhgqsglphlmuobp HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/dqbveqinmlvdhkgcvuxfaouycdldzmsk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/tmtkoeovhbmeiqczjegfsxrthuejatbv HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/hvoqilwqzkypfysrntnplftwmvdmnibk HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "PUT /devstoreaccount1/cont/bhpdavdwvnukrqerjlrpxpqlahmmikxm HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "GET /devstoreaccount1/cont/mbqwgoxjgjrybyealolqmmtuiubmtyid HTTP/1.1" 206 62
127.0.0.1 - - [16/Jul/2026:02:38:35 +0000] "GET /devstoreaccount1/cont/fbfhrqpwowdatjuaomfapnfzhpvdxjsf HTTP/1.1" 206 100041
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/syrnvrlkoyrcerafoognrfvtbekjqupa HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/uplxqkxmjecngtfinxusfxwopyquimxi HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/vvsvezttidrmorqdawjbgpcfhfhkzbbj HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/gzvblcjggfocsgqiqiszyuuqiclqzgul HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/iyyxvoqzjuqeuxovhfnticdbxdysyfas HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/bhpdavdwvnukrqerjlrpxpqlahmmikxm HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/dqbveqinmlvdhkgcvuxfaouycdldzmsk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/njftthzsueeabnmichajaypwkmyqviuw HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/mbqwgoxjgjrybyealolqmmtuiubmtyid HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/fbfhrqpwowdatjuaomfapnfzhpvdxjsf HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/lyemyzfgwjzyxferzybeysysceiwkzlk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/iuaffvmyvzbvoxzhnmhgqsglphlmuobp HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/hvoqilwqzkypfysrntnplftwmvdmnibk HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "DELETE /devstoreaccount1/cont/tmtkoeovhbmeiqczjegfsxrthuejatbv HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/nwncggjluoxrzyfimxvbpdvyvaewqvki HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/yegzxoqoxlmuraooylfcjrxonounwvwt HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/ehellgepwmhaywxzdzcfkmxbvgyzrimq HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/qjckdjusbyzrwurxiocjbqcpcnjfxnca HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/atjidslrshokfvcfrbxjjlgymdxxphle HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/ubvksbsdeorfvejfpaqrilczqsxheppm HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/afygrnckpryyjbxqhvafvgeqqwvgplxc HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/ydtjefaclbzhsebjbvqgighxqyivaeah HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:44 +0000] "PUT /devstoreaccount1/cont/ecijvhlyxgieujnjzstwmjksfgpiuctl HTTP/1.1" 201 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/iyyxvoqzjuqeuxovhfnticdbxdysyfas HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/uplxqkxmjecngtfinxusfxwopyquimxi HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/syrnvrlkoyrcerafoognrfvtbekjqupa HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/qhxndspczvhwqswsdiitutodyskgovrr HTTP/1.1" 404 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/etvyntczlnmkrmbgywphhimlabiphenj HTTP/1.1" 404 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/uigwcbxnppwigrbchsmcygkdguyoamkg HTTP/1.1" 404 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/gzvblcjggfocsgqiqiszyuuqiclqzgul HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/vvsvezttidrmorqdawjbgpcfhfhkzbbj HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/ecijvhlyxgieujnjzstwmjksfgpiuctl HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/ubvksbsdeorfvejfpaqrilczqsxheppm HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/qjckdjusbyzrwurxiocjbqcpcnjfxnca HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/yegzxoqoxlmuraooylfcjrxonounwvwt HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/nwncggjluoxrzyfimxvbpdvyvaewqvki HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/ehellgepwmhaywxzdzcfkmxbvgyzrimq HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/atjidslrshokfvcfrbxjjlgymdxxphle HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/ydtjefaclbzhsebjbvqgighxqyivaeah HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/afygrnckpryyjbxqhvafvgeqqwvgplxc HTTP/1.1" 202 -
127.0.0.1 - - [16/Jul/2026:02:38:45 +0000] "DELETE /devstoreaccount1/cont/tqajdfyoqvprlcpzmryofkfnvtonllwl HTTP/1.1" 202 -
2026-07-15 22:38:45 02226_filesystem_cache_profile_events: [ OK ] 36.91 sec.
2026-07-15 22:38:48 02225_unwinder_dwarf_version: [ OK ] 2.96 sec.
2026-07-15 22:38:59 02222_create_table_without_columns_metadata: [ OK ] 10.60 sec.
2026-07-15 22:39:08 02207_allow_plaintext_and_no_password: [ OK ] 9.26 sec.
2026-07-15 22:39:14 02185_values_schema_inference: [ OK ] 6.25 sec.
2026-07-15 22:39:18 02184_ipv6_parsing: [ OK ] 4.09 sec.
2026-07-15 22:39:22 02182_json_each_row_schema_inference: [ OK ] 3.59 sec.
2026-07-15 22:39:24 02179_dict_reload_on_cluster: [ OK ] 2.01 sec.
2026-07-15 22:39:27 02177_temporary_table_current_database_http_session: [ OK ] 2.61 sec.
2026-07-15 22:39:28 02168_avro_bug: [ OK ] 1.05 sec.
2026-07-15 22:39:32 02166_arrow_dictionary_inference: [ OK ] 3.79 sec.
2026-07-15 22:39:34 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 2.17 sec.
2026-07-15 22:39:36 02148_sql_user_defined_function_subquery: [ OK ] 1.51 sec.
2026-07-15 22:39:37 02126_identity_user_defined_function: [ OK ] 1.04 sec.
2026-07-15 22:39:38 02125_recursive_sql_user_defined_functions: [ OK ] 1.29 sec.
2026-07-15 22:39:38 02125_many_mutations_2: [ SKIPPED ] 0.00 sec.
2026-07-15 22:39:38 Reason: not running for current build
2026-07-15 22:39:44 02105_table_function_file_partiotion_by: [ OK ] 5.89 sec.
2026-07-15 22:39:48 02104_json_strings_nullable_string: [ OK ] 4.03 sec.
2026-07-15 22:39:49 02103_sql_user_defined_functions_composition: [ OK ] 0.95 sec.
2026-07-15 22:40:15 02103_tsv_csv_custom_null_representation: [ OK ] 26.13 sec.
2026-07-15 22:40:17 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 1.07 sec.
2026-07-15 22:40:18 02098_sql_user_defined_functions_aliases: [ OK ] 0.97 sec.
2026-07-15 22:40:19 02096_sql_user_defined_function_alias: [ OK ] 0.91 sec.
2026-07-15 22:40:20 02096_rename_atomic_hang: [ OK ] 1.57 sec.
2026-07-15 22:40:33 02051_read_settings: [ OK ] 12.30 sec.
2026-07-15 22:40:35 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 2.16 sec.
2026-07-15 22:41:21 02026_storage_filelog_largefile: [ OK ] 46.17 sec.
2026-07-15 22:41:23 02025_dictionary_view_different_db: [ OK ] 1.45 sec.
2026-07-15 22:41:24 02015_column_default_dict_get_identifier: [ OK ] 1.40 sec.
2026-07-15 22:41:31 02015_global_in_threads: [ OK ] 7.27 sec.
2026-07-15 22:41:33 02011_dictionary_empty_attribute_list: [ OK ] 1.20 sec.
2026-07-15 22:41:35 01999_grant_with_replace: [ OK ] 1.86 sec.
2026-07-15 22:41:36 01948_dictionary_quoted_database_name: [ OK ] 1.26 sec.
2026-07-15 22:41:38 01915_create_or_replace_dictionary: [ OK ] 1.56 sec.
2026-07-15 22:41:40 01913_exact_rows_before_limit_full: [ OK ] 2.37 sec.
2026-07-15 22:41:42 01910_view_dictionary: [ OK ] 1.53 sec.
2026-07-15 22:41:45 01903_ssd_cache_dictionary_array_type: [ OK ] 3.42 sec.
2026-07-15 22:41:48 01902_table_function_merge_db_repr: [ OK ] 3.02 sec.
2026-07-15 22:41:51 01901_test_attach_partition_from: [ OK ] 3.17 sec.
2026-07-15 22:41:55 01889_postgresql_protocol_null_fields: [ OK ] 3.28 sec.
2026-07-15 22:41:56 01870_buffer_flush: [ OK ] 1.15 sec.
2026-07-15 22:41:57 01856_create_function: [ OK ] 1.30 sec.
2026-07-15 22:42:03 01853_dictionary_cache_duplicates: [ OK ] 5.53 sec.
2026-07-15 22:42:04 01850_dist_INSERT_preserve_error: [ OK ] 1.30 sec.
2026-07-15 22:42:05 01837_database_memory_ddl_dictionaries: [ OK ] 1.10 sec.
2026-07-15 22:42:07 01821_table_comment: [ OK ] 1.50 sec.
2026-07-15 22:42:09 01785_dictionary_element_count: [ OK ] 2.41 sec.
2026-07-15 22:42:12 01778_hierarchical_dictionaries: [ OK ] 2.71 sec.
2026-07-15 22:42:16 01754_direct_dictionary_complex_key: [ OK ] 3.52 sec.
2026-07-15 22:42:20 01753_direct_dictionary_simple_key: [ OK ] 4.02 sec.
2026-07-15 22:42:22 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.51 sec.
2026-07-15 22:42:23 01746_executable_pool_dictionary: [ OK ] 1.41 sec.
2026-07-15 22:42:30 01737_clickhouse_server_wait_server_pool_long: [ OK ] 7.18 sec.
2026-07-15 22:42:36 01722_long_brotli_http_compression_json_format: [ OK ] 5.41 sec.
2026-07-15 22:42:37 01721_engine_file_truncate_on_insert: [ OK ] 1.30 sec.
2026-07-15 22:42:37 01710_projection_vertical_merges: [ SKIPPED ] 0.00 sec.
2026-07-15 22:42:37 Reason: not running for current build
2026-07-15 22:42:41 01681_cache_dictionary_simple_key: [ OK ] 3.62 sec.
2026-07-15 22:42:43 01676_dictget_in_default_expression: [ OK ] 2.01 sec.
2026-07-15 22:42:45 01670_dictionary_create_key_expression: [ OK ] 1.46 sec.
2026-07-15 22:42:46 01646_system_restart_replicas_smoke: [ OK ] 1.51 sec.
2026-07-15 22:42:54 01643_replicated_merge_tree_fsync_smoke: [ OK ] 8.17 sec.
2026-07-15 22:42:57 01615_random_one_shard_insertion: [ OK ] 2.71 sec.
2026-07-15 22:42:59 01603_rename_overwrite_bug: [ OK ] 1.92 sec.
2026-07-15 22:45:40 01600_detach_permanently: [ OK ] 160.62 sec.
2026-07-15 22:47:05 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 85.47 sec.
2026-07-15 22:47:07 01575_disable_detach_table_of_dictionary: [ OK ] 1.25 sec.
2026-07-15 22:47:10 01530_drop_database_atomic_sync: [ OK ] 3.13 sec.
2026-07-15 22:47:15 01527_clickhouse_local_optimize: [ OK ] 4.89 sec.
2026-07-15 22:47:16 01526_complex_key_dict_direct_layout: [ OK ] 1.43 sec.
2026-07-15 22:47:23 01524_do_not_merge_across_partitions_select_final: [ OK ] 6.42 sec.
2026-07-15 22:47:25 01517_drop_mv_with_inner_table: [ OK ] 1.71 sec.
2026-07-15 22:47:32 01507_clickhouse_server_start_with_embedded_config: [ OK ] 7.51 sec.
2026-07-15 22:47:39 01501_cache_dictionary_all_fields: [ OK ] 6.60 sec.
2026-07-15 22:47:42 01474_executable_dictionary: [ OK ] 3.27 sec.
2026-07-15 22:47:44 01471_calculate_ttl_during_merge: [ OK ] 2.16 sec.
2026-07-15 22:48:41 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 56.49 sec.
2026-07-15 22:51:21 01459_manual_write_to_replicas: [ OK ] 159.60 sec.
2026-07-15 22:51:22 01457_create_as_table_function_structure: [ OK ] 1.83 sec.
2026-07-15 22:51:24 01455_rank_correlation_spearman: [ OK ] 1.66 sec.
2026-07-15 22:51:50 01454_storagememory_data_race_challenge: [ OK ] 25.64 sec.
2026-07-15 22:52:02 01417_freeze_partition_verbose_zookeeper: [ OK ] 12.39 sec.
2026-07-15 22:52:24 01417_freeze_partition_verbose: [ OK ] 21.63 sec.
2026-07-15 22:53:16 01414_mutations_and_errors_zookeeper: [ OK ] 51.45 sec.
2026-07-15 22:53:32 01410_nullable_key_more_tests: [ OK ] 15.80 sec.
2026-07-15 22:53:46 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 14.63 sec.
2026-07-15 22:53:53 01360_materialized_view_with_join_on_query_log: [ OK ] 6.13 sec.
2026-07-15 22:53:56 01356_view_threads: [ OK ] 2.96 sec.
2026-07-15 22:54:10 01320_create_sync_race_condition_zookeeper: [ OK ] 14.33 sec.
2026-07-15 22:54:30 01307_multiple_leaders_zookeeper: [ OK ] 20.28 sec.
2026-07-15 22:54:44 01305_replica_create_drop_zookeeper: [ OK ] 13.66 sec.
2026-07-15 22:55:17 01301_aggregate_state_exception_memory_leak: [ OK ] 32.75 sec.
2026-07-15 22:55:22 01297_create_quota: [ OK ] 4.62 sec.
2026-07-15 22:55:24 01295_create_row_policy: [ OK ] 1.96 sec.
2026-07-15 22:55:25 01294_system_distributed_on_cluster: [ OK ] 1.26 sec.
2026-07-15 22:55:28 01294_create_settings_profile: [ OK ] 2.66 sec.
2026-07-15 22:55:30 01293_system_distribution_queue: [ OK ] 1.71 sec.
2026-07-15 22:55:31 01281_unsucceeded_insert_select_queries_counter: [ OK ] 1.72 sec.
2026-07-15 22:55:31 01281_group_by_limit_memory_tracking: [ SKIPPED ] 0.00 sec.
2026-07-15 22:55:31 Reason: not running for current build
2026-07-15 22:55:41 01280_ssd_complex_key_dictionary: [ OK ] 10.06 sec.
2026-07-15 23:00:05 01275_parallel_mv: [ OK ] 263.31 sec.
2026-07-15 23:00:08 01251_dict_is_in_infinite_loop: [ OK ] 3.07 sec.
2026-07-15 23:00:09 01225_show_create_table_from_dictionary: [ OK ] 1.05 sec.
2026-07-15 23:01:03 01192_rename_database_zookeeper: [ OK ] 53.82 sec.
2026-07-15 23:01:04 01164_alter_memory_database: [ OK ] 1.50 sec.
2026-07-15 23:01:09 01155_rename_move_materialized_view: [ OK ] 4.32 sec.
2026-07-15 23:03:04 01154_move_partition_long: [ OK ] 114.91 sec.
2026-07-15 23:03:07 01153_attach_mv_uuid: [ OK ] 2.93 sec.
2026-07-15 23:03:11 01148_zookeeper_path_macros_unfolding: [ OK ] 4.37 sec.
2026-07-15 23:03:13 01119_weird_user_names: [ OK ] 1.36 sec.
2026-07-15 23:08:34 01111_create_drop_replicated_db_stress: [ OK ] 321.50 sec.
2026-07-15 23:08:36 01110_dictionary_layout_without_arguments: [ OK ] 1.20 sec.
2026-07-15 23:08:39 01103_distributed_product_mode_local_column_renames: [ OK ] 2.81 sec.
2026-07-15 23:08:48 01098_temporary_and_external_tables: [ OK ] 9.51 sec.
2026-07-15 23:08:56 01091_num_threads: [ OK ] 7.75 sec.
2026-07-15 23:09:00 01085_max_distributed_connections_http: [ OK ] 3.57 sec.
2026-07-15 23:09:46 01083_expressions_in_engine_arguments: [ OK ] 46.51 sec.
2026-07-15 23:09:49 01082_window_view_watch_limit: [ OK ] 2.73 sec.
2026-07-15 23:10:41 01079_parallel_alter_detach_table_zookeeper: [ OK ] 52.43 sec.
2026-07-15 23:10:53 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 11.23 sec.
2026-07-15 23:10:54 01075_allowed_client_hosts: [ OK ] 1.26 sec.
2026-07-15 23:11:01 01075_window_view_proc_tumble_to_now_populate: [ OK ] 7.18 sec.
2026-07-15 23:11:05 01070_materialize_ttl: [ OK ] 3.82 sec.
2026-07-15 23:11:08 01070_mutations_with_dependencies: [ OK ] 3.02 sec.
2026-07-15 23:11:13 01070_modify_ttl: [ OK ] 4.22 sec.
2026-07-15 23:11:23 01069_window_view_proc_tumble_watch: [ OK ] 10.05 sec.
2026-07-15 23:11:26 01065_window_view_event_hop_watch_bounded: [ OK ] 3.40 sec.
2026-07-15 23:11:32 01060_shutdown_table_after_detach: [ OK ] 5.99 sec.
2026-07-15 23:11:42 01055_window_view_proc_hop_to: [ OK ] 9.51 sec.
2026-07-15 23:11:50 01053_ssd_dictionary: [ OK ] 8.25 sec.
2026-07-15 23:12:04 01038_dictionary_lifetime_min_zero_sec: [ OK ] 13.46 sec.
2026-07-15 23:12:06 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 1.67 sec.
2026-07-15 23:12:08 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 1.92 sec.
2026-07-15 23:12:09 01023_materialized_view_query_context: [ OK ] 1.65 sec.
2026-07-15 23:12:27 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 17.10 sec.
2026-07-15 23:12:36 01018_ddl_dictionaries_bad_queries: [ OK ] 9.47 sec.
2026-07-15 23:13:04 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 28.33 sec.
2026-07-15 23:13:28 01014_lazy_database_basic: [ OK ] 23.32 sec.
2026-07-15 23:13:34 01013_sync_replica_timeout_zookeeper: [ OK ] 6.40 sec.
2026-07-15 23:13:52 01007_r1r2_w_r2r1_deadlock: [ OK ] 17.02 sec.
2026-07-15 23:14:09 01004_rename_deadlock: [ OK ] 17.35 sec.
2026-07-15 23:14:11 00985_merge_stack_overflow: [ OK ] 2.30 sec.
2026-07-15 23:14:14 00971_query_id_in_logs: [ OK ] 2.98 sec.
2026-07-15 23:14:18 00963_achimbab: [ OK ] 3.83 sec.
2026-07-15 23:14:23 00950_dict_get: [ OK ] 4.41 sec.
2026-07-15 23:14:23 00877_memory_limit_for_new_delete: [ SKIPPED ] 0.00 sec.
2026-07-15 23:14:23 Reason: not running for current build
2026-07-15 23:14:57 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 33.70 sec.
2026-07-15 23:14:59 00722_inner_join: [ OK ] 2.46 sec.
2026-07-15 23:15:02 00693_max_block_size_system_tables_columns: [ OK ] 2.63 sec.
2026-07-15 23:15:14 00623_truncate_table_throw_exception: [ OK ] 12.00 sec.
2026-07-15 23:15:19 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 5.20 sec.
2026-07-15 23:15:34 00463_long_sessions_in_http_interface: [ OK ] 14.40 sec.
2026-07-15 23:15:35 00332_quantile_timing_memory_leak: [ OK ] 1.51 sec.
2026-07-15 23:15:37 00309_formats_case_insensitive: [ OK ] 1.76 sec.
2026-07-15 23:15:37 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec.
2026-07-15 23:15:37 Reason: skip
2026-07-15 23:15:37
2026-07-15 23:15:37 Having 1 errors! 266 tests passed. 15 tests skipped. 4238.74 s elapsed (MainProcess).
2026-07-15 23:16:00 Won't run stateful tests because test data wasn't loaded.
2026-07-15 23:16:00 Checking the hung queries: done
2026-07-15 23:16:00
2026-07-15 23:16:00 No queries hung.
2026-07-15 23:16:00 All tests have finished.
2026-07-15 23:16:00
2026-07-15 23:16:00 Top patterns of log messages:
2026-07-15 23:16:00
2026-07-15 23:16:00 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-07-15 23:16:00
2026-07-15 23:16:00 1. 217497 0.089 9.42 MiB 0.038 1 1087 ['Trace'] 1 is disk {} eligible for search: {}
2026-07-15 23:16:00 2. 121314 0.05 23.22 MiB 0.093 1 442 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2026-07-15 23:16:00 3. 121181 0.05 18.15 MiB 0.072 37644 438 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2026-07-15 23:16:00 4. 97330 0.04 2.35 MiB 0.009 1 888 ['Trace'] 0.001 Query to stage {}{}
2026-07-15 23:16:00 5. 96497 0.039 2.66 MiB 0.011 1 258 ['Debug'] 0 Processed in {} sec.
2026-07-15 23:16:00 6. 96181 0.039 4.55 MiB 0.018 1 887 ['Trace'] 0.001 Query from stage {} to stage {}{}
2026-07-15 23:16:00 7. 75833 0.031 3.31 MiB 0.013 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2026-07-15 23:16:00 8. 66143 0.027 5.15 MiB 0.021 1 414 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2026-07-15 23:16:00 9. 63270 0.026 2.07 MiB 0.008 1 1896 ['Trace'] 0 Aggregation method: {}
2026-07-15 23:16:00 10. 58498 0.024 5.15 MiB 0.021 1 1892 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-07-15 23:16:00 11. 49262 0.02 3.38 MiB 0.013 1 1776 ['Trace'] 0.48 Reserved {} on local disk {}, having unreserved {}.
2026-07-15 23:16:00 12. 47532 0.019 3.76 MiB 0.015 1 1856 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2026-07-15 23:16:00 13. 46724 0.019 3.16 MiB 0.013 2633 1772 ['Trace'] 0.468 Trying to reserve {} using storage policy from min volume index {}
2026-07-15 23:16:00 14. 46216 0.019 496.46 KiB 0.002 1 1719 ['Trace'] 0 Aggregating
2026-07-15 23:16:00 15. 44399 0.018 5.08 MiB 0.02 2645 1212 ['Trace'] 0.353 Renaming temporary part {} to {} with tid {}.
2026-07-15 23:16:00 16. 44220 0.018 2.03 MiB 0.008 1 1267 ['Trace'] 0.274 filled checksums {}
2026-07-15 23:16:00 17. 38059 0.016 1.72 MiB 0.007 38059 597 ['Debug'] 0.996 Authenticating user '{}' from {}
2026-07-15 23:16:00 18. 38034 0.016 4.17 MiB 0.017 38034 597 ['Debug'] 0.996 {} Authenticated with global context as user {}
2026-07-15 23:16:00 19. 37981 0.016 3.26 MiB 0.013 37981 587 ['Debug'] 0.995 {} Logout, user_id: {}
2026-07-15 23:16:00 20. 37626 0.015 2.69 MiB 0.011 37626 438 ['Debug'] 1 Creating session context with user_id: {}
2026-07-15 23:16:00 21. 36242 0.015 2.77 MiB 0.011 1562 286 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2026-07-15 23:16:00 22. 34054 0.014 1.60 MiB 0.006 1 461 ['Debug'] 0.218 Peak memory usage{}: {}.
2026-07-15 23:16:00 23. 26306 0.011 5.48 MiB 0.022 3 399 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2026-07-15 23:16:00 24. 26297 0.011 18.77 MiB 0.075 2 399 ['Trace'] 1 Request URI: {}
2026-07-15 23:16:00 25. 25723 0.011 527.52 KiB 0.002 2 399 ['Debug'] 0.136 Done processing query
2026-07-15 23:16:00 26. 22376 0.009 2.07 MiB 0.008 1 95 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2026-07-15 23:16:00 27. 20390 0.008 2.34 MiB 0.009 1 2 ['Trace'] 1 Creating part at path {}
2026-07-15 23:16:00 28. 16160 0.007 362.97 KiB 0.001 1 1134 ['Trace'] 0.001 Merging aggregated data
2026-07-15 23:16:00 29. 16118 0.007 488.33 KiB 0.002 1727 356 ['Debug'] 0.007 Key condition: {}
2026-07-15 23:16:00 30. 15888 0.006 698.20 KiB 0.003 1722 356 ['Trace'] 0.007 Filtering marks by primary and secondary keys
2026-07-15 23:16:00 31. 15616 0.006 1.74 MiB 0.007 1715 356 ['Debug'] 0.007 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2026-07-15 23:16:00 32. 15553 0.006 508.90 KiB 0.002 2 261 ['Trace'] 1 TCP Request. Address: {}
2026-07-15 23:16:00 33. 15551 0.006 1.47 MiB 0.006 1 261 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2026-07-15 23:16:00 34. 15471 0.006 407.93 KiB 0.002 1 249 ['Debug'] 1 Done processing connection.
2026-07-15 23:16:00 35. 14145 0.006 732.11 KiB 0.003 1504 350 ['Trace'] 0.008 Spreading mark ranges among streams (default reading)
2026-07-15 23:16:00 36. 13847 0.006 1.07 MiB 0.004 575 1257 ['Trace'] 0.805 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2026-07-15 23:16:00 37. 12693 0.005 1.11 MiB 0.004 303 528 ['Trace'] 0.997 Insert entry {} to queue with type {}
2026-07-15 23:16:00 38. 12449 0.005 1.04 MiB 0.004 688 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {}
2026-07-15 23:16:00 39. 12405 0.005 957.03 KiB 0.004 1 321 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2026-07-15 23:16:00 40. 11801 0.005 495.55 KiB 0.002 3568 229 ['Debug'] 0.011 Found {} non used tables in detached tables.
2026-07-15 23:16:00 41. 11801 0.005 702.99 KiB 0.003 3568 229 ['Debug'] 0.011 There are {} detached tables. Start searching non used tables.
2026-07-15 23:16:00 42. 11790 0.005 1.22 MiB 0.005 1 64 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2026-07-15 23:16:00 43. 11731 0.005 684.61 KiB 0.003 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {}
2026-07-15 23:16:00 44. 11730 0.005 427.69 KiB 0.002 18 18 ['Trace'] 1 Flushed system log up to offset {}
2026-07-15 23:16:00 45. 11696 0.005 1.59 MiB 0.006 547 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2026-07-15 23:16:00 46. 10451 0.004 602.17 KiB 0.002 303 528 ['Debug'] 0.997 Pulling {} entries to queue: {} - {}
2026-07-15 23:16:00 47. 10451 0.004 265.37 KiB 0.001 303 528 ['Debug'] 0.997 Pulled {} entries to queue.
2026-07-15 23:16:00 48. 8320 0.003 292.50 KiB 0.001 1 957 ['Trace'] 0.008 Converting aggregated data to blocks
2026-07-15 23:16:00 49. 8286 0.003 881.85 KiB 0.003 1 954 ['Debug'] 0.006 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.)
2026-07-15 23:16:00 50. 8274 0.003 435.36 KiB 0.002 647 610 ['Debug'] 0.926 Selected {} parts from {} to {}
2026-07-15 23:16:00 51. 7706 0.003 863.13 KiB 0.003 2137 1173 ['Debug'] 0.984 Removing {} parts from filesystem (serially): Parts: [{}]
2026-07-15 23:16:00 52. 7505 0.003 1.13 MiB 0.004 1 167 ['Trace'] 0.021 PREWHERE condition was split into {} steps: {}
2026-07-15 23:16:00 53. 7287 0.003 206.37 KiB 0.001 1 1115 ['Debug'] 1 Stop worker in {}
2026-07-15 23:16:00 54. 7287 0.003 556.41 KiB 0.002 1 163 ['Debug'] 0.001 Schedule load job '{}' into {}
2026-07-15 23:16:00 55. 7287 0.003 535.06 KiB 0.002 1 1042 ['Debug'] 1 Execute load job '{}' in {}
2026-07-15 23:16:00 56. 7287 0.003 506.59 KiB 0.002 1 1042 ['Debug'] 1 Finish load job '{}' with status {}
2026-07-15 23:16:00 57. 7287 0.003 284.65 KiB 0.001 1 1202 ['Debug'] 0.5 Spawn loader worker #{} in {}
2026-07-15 23:16:00 58. 7286 0.003 677.30 KiB 0.003 1 163 ['Debug'] 0 Prioritize load job '{}': {} -> {}
2026-07-15 23:16:00 59. 7263 0.003 63.83 KiB 0 2 163 ['Trace'] 0.001 No tables
2026-07-15 23:16:00 60. 7242 0.003 240.46 KiB 0.001 1 1221 ['Debug'] 0.5 Change current priority: {} -> {}
2026-07-15 23:16:00 61. 6844 0.003 2.98 MiB 0.012 2 24 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {}
2026-07-15 23:16:00 62. 6829 0.003 569.11 KiB 0.002 1 103 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2026-07-15 23:16:00 63. 6829 0.003 233.21 KiB 0.001 1 103 ['Debug'] 0 Selected MergeAlgorithm: {}
2026-07-15 23:16:00 64. 6817 0.003 886.92 KiB 0.003 1 103 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2026-07-15 23:16:00 65. 6803 0.003 451.88 KiB 0.002 488 103 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2026-07-15 23:16:00 66. 6732 0.003 837.04 KiB 0.003 10 510 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now.
2026-07-15 23:16:00 67. 6563 0.003 815.39 KiB 0.003 1 2 ['Trace'] 1 MemoryTracking: was {}, peak {}, free memory in arenas {}, will set to {} (RSS), difference: {}
2026-07-15 23:16:00 68. 6445 0.003 188.82 KiB 0.001 681 524 ['Debug'] 0.992 Updating strategy picker state
2026-07-15 23:16:00 69. 6320 0.003 1.23 MiB 0.005 1 1087 ['Information'] 1 Removing metadata {} of dropped table {}
2026-07-15 23:16:00 70. 6318 0.003 728.05 KiB 0.003 1 181 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {}
2026-07-15 23:16:00 71. 6318 0.003 468.91 KiB 0.002 1 181 ['Debug'] 0 Waiting for table {} to be finally dropped
2026-07-15 23:16:00 72. 6039 0.002 436.42 KiB 0.002 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables
2026-07-15 23:16:00 73. 5778 0.002 1.10 MiB 0.004 1 237 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {}
2026-07-15 23:16:00 74. 5713 0.002 541.00 KiB 0.002 224 277 ['Debug'] 0.973 Removing {} parts from memory: Parts: [{}]
2026-07-15 23:16:00 75. 5707 0.002 535.13 KiB 0.002 220 272 ['Trace'] 0.974 Found {} old parts to remove. Parts: [{}]
2026-07-15 23:16:00 76. 5680 0.002 452.52 KiB 0.002 1 1083 ['Trace'] 0.001 Statistics updated for key={}: new sum_of_sizes={}, median_size={}
2026-07-15 23:16:00 77. 5622 0.002 173.90 KiB 0.001 252 939 ['Trace'] 0.011 Found {} range {}in {} steps
2026-07-15 23:16:00 78. 5622 0.002 166.59 KiB 0.001 252 939 ['Trace'] 0.011 Found (RIGHT) boundary mark: {}
2026-07-15 23:16:00 79. 5622 0.002 389.54 KiB 0.002 252 939 ['Trace'] 0.011 Running binary search on index range for part {} ({} marks)
2026-07-15 23:16:00 80. 5622 0.002 160.92 KiB 0.001 252 939 ['Trace'] 0.011 Found (LEFT) boundary mark: {}
2026-07-15 23:16:00 81. 5472 0.002 214.91 KiB 0.001 241 35 ['Debug'] 0.639 Committing part {} to zookeeper
2026-07-15 23:16:00 82. 5142 0.002 196.04 KiB 0.001 238 32 ['Debug'] 0.679 Part {} committed to zookeeper
2026-07-15 23:16:00 83. 4802 0.002 178.44 KiB 0.001 343 201 ['Debug'] 0.018 Reading approx. {} rows with {} streams
2026-07-15 23:16:00 84. 4760 0.002 153.31 KiB 0.001 20 70 ['Debug'] 0 Requested flush up to offset {}
2026-07-15 23:16:00 85. 4621 0.002 555.88 KiB 0.002 1 95 ['Trace'] 0 Have {} pending inserts with total {} bytes of data for query '{}'
2026-07-15 23:16:00 86. 4593 0.002 333.71 KiB 0.001 358 867 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2026-07-15 23:16:00 87. 4591 0.002 322.11 KiB 0.001 1 585 ['Trace'] 0.86 Rolling back transaction {}{}
2026-07-15 23:16:00 88. 4229 0.002 455.43 KiB 0.002 158 33 ['Debug'] 0.998 Fetching part {} from {}:{}
2026-07-15 23:16:00 89. 4178 0.002 304.12 KiB 0.001 1 191 ['Trace'] 0.014 The min valid primary key position for moving to the tail of PREWHERE is {}
2026-07-15 23:16:00 90. 3974 0.002 341.52 KiB 0.001 158 35 ['Trace'] 0.999 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2026-07-15 23:16:00 91. 3974 0.002 143.56 KiB 0.001 158 35 ['Trace'] 0.999 Checking disk {} with type {}
2026-07-15 23:16:00 92. 3896 0.002 84.37 KiB 0 290 515 ['Trace'] 1 Execution took {} ms.
2026-07-15 23:16:00 93. 3805 0.002 140.85 KiB 0.001 370 143 ['Debug'] 0.001 MinMax index condition: {}
2026-07-15 23:16:00 94. 3750 0.002 238.21 KiB 0.001 1 166 ['Trace'] 0.015 Condition {} moved to PREWHERE
2026-07-15 23:16:00 95. 3634 0.001 298.76 KiB 0.001 3587 163 ['Information'] 0.001 Metadata processed, database {} has {} tables and {} dictionaries in total.
2026-07-15 23:16:00 96. 3634 0.001 216.08 KiB 0.001 1 163 ['Information'] 0.001 Parsed metadata of {} tables in {} databases in {} sec
2026-07-15 23:16:00 97. 3593 0.001 249.84 KiB 0.001 1 163 ['Debug'] 0 Wait load job '{}' in {}
2026-07-15 23:16:00 98. 3530 0.001 268.89 KiB 0.001 25 159 ['Trace'] 0.951 Settings: readonly = {}, allow_ddl = {}, allow_introspection_functions = {}
2026-07-15 23:16:00 99. 3530 0.001 310.41 KiB 0.001 25 159 ['Trace'] 0.951 List of all grants including implicit: {}
2026-07-15 23:16:00 100. 3530 0.001 186.44 KiB 0.001 25 159 ['Trace'] 0.951 List of all grants: {}
2026-07-15 23:16:00
2026-07-15 23:16:03 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2026-07-15 23:16:03
2026-07-15 23:16:03
2026-07-15 23:16:03
2026-07-15 23:16:03 Top messages without format string (fmt::runtime):
2026-07-15 23:16:03
2026-07-15 23:16:03 count pattern runtime_message line
2026-07-15 23:16:03
2026-07-15 23:16:03 1. 1348 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2026-07-15 23:16:03 2. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 11 ('#'): #. Unrecognized token: '#'. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:52308) (comment: 02192_comment_error.sh) (in query: select 42 #), ('/executeQuery.cpp',221)
2026-07-15 23:16:03 3. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT defaultValueOfTypeName(''). (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:55528) (comment: 00534_functions_bad_arguments7.sh) (in query: SELECT defaultValueOfTypeName( ('/executeQuery.cpp',221)
2026-07-15 23:16:03 4. 12 CodeDBExceptionReceivedfromDBExc Code: 36. DB::Exception: Received from 127.0.0.1:9000. DB::Exception: Chosen number of marks to read is zero (likely because of weird interference of settings). Stack trace:
2026-07-15 23:16:03
2026-07-15 23:16:03 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exceptio ('/executeQuery.cpp',221)
2026-07-15 23:16:03 5. 8 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 1 (' '): . Unrecognized token: ' '. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:58402) (comment: 00746_sql_fuzzy.sh) (in query: SELEC ('/executeQuery.cpp',221)
2026-07-15 23:16:03 6. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:51052) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221)
2026-07-15 23:16:03 7. 8 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace:
2026-07-15 23:16:03
2026-07-15 23:16:03 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String cons ('/executeQuery.cpp',221)
2026-07-15 23:16:03 8. 6 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'LINESTRING'' in () (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:55528) (comment: 00534_functions_bad_arguments7.sh) ('/executeQuery.cpp',221)
2026-07-15 23:16:03 9. 6 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:59358) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM fuzzQuery('');), Stack trace (when copying this message, always include the ('/executeQuery.cpp',221)
2026-07-15 23:16:03 10. 6 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'LINESTRING'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',765)
2026-07-15 23:16:03 11. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221)
2026-07-15 23:16:03 12. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:33418) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221)
2026-07-15 23:16:03 13. 3 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:58402) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM s3('\0');), Stack trace (when copying ('/executeQuery.cpp',221)
2026-07-15 23:16:03 14. 3 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-07-15 23:16:03
2026-07-15 23:16:03 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(Strin ('/TCPHandler.cpp',765)
2026-07-15 23:16:03 15. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221)
2026-07-15 23:16:03 16. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10546.a ('/executeQuery.cpp',221)
2026-07-15 23:16:03 17. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221)
2026-07-15 23:16:03 18. 1 BECOMELEADERappendednewconfigat [BECOME LEADER] appended new config at 1 ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 19. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_pyd4i05b/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273)
2026-07-15 23:16:03 20. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-07-15 23:16:03
2026-07-15 23:16:03 0. ./contrib/llvm-project/libcxx/include/exception:141: std::runtime_error::runtime_error(char const ('/TCPHandler.cpp',765)
2026-07-15 23:16:03 21. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 22. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 23. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0)
2026-07-15 23:16:03 24. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:48584) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap ('/executeQuery.cpp',221)
2026-07-15 23:16:03 25. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0
2026-07-15 23:16:03 peer 1, DC ID 0, localhost:9234, voting member, 1
2026-07-15 23:16:03 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 26. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 27. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 28. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43)
2026-07-15 23:16:03 29. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2026-07-15 23:16:03
2026-07-15 23:16:03 0. ./contrib/llvm-project/libcxx/include/exception:141: st ('/TCPHandler.cpp',765)
2026-07-15 23:16:17 30. 1 startingup starting up ('',0)
2026-07-15 23:16:17
2026-07-15 23:16:17
2026-07-15 23:16:17
2026-07-15 23:16:17 Top messages not matching their format strings:
2026-07-15 23:16:17
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 1. 1383 logTrace Function Test
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 2. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 267 /var/lib/clickhouse/store/68d/68dc63a2-d39b-4d49-992c-f1c745994b51/tmp_merge_202607_190_223_4/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 1 similar messages)
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 3. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:50662) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2026-07-15 23:16:17
2026-07-15 23:16:17 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000343c5254
2026-07-15 23:16:17 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb62c9
2026-07-15 23:16:17 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa94445
2026-07-15 23:16:17 3. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x000000000cbaaa34
2026-07-15 23:16:17 4. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x000000000cba99af
2026-07-15 23:16:17 5. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x000000000cbc35fd
2026-07-15 23:16:17 6. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000cbc1ba1
2026-07-15 23:16:17 7. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aacf135
2026-07-15 23:16:17 8. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd2e5b
2026-07-15 23:16:17 9. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd465c
2026-07-15 23:16:17 10. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd8030
2026-07-15 23:16:17 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000002875645d
2026-07-15 23:16:17 12. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x000000002da3180e
2026-07-15 23:16:17 13. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x000000001b4a04bf
2026-07-15 23:16:17 14. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x000000002d3924b9
2026-07-15 23:16:17 15. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:0: DB::ExecutionThreadContext::executeTask() @ 0x000000002d3d1c4e
2026-07-15 23:16:17 16. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x000000002d3b8a31
2026-07-15 23:16:17 17. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x000000002d3b73dc
2026-07-15 23:16:17 18. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x000000002d3b6edb
2026-07-15 23:16:17 19. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:94: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x000000002d3da957
2026-07-15 23:16:17 20. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x000000001af7fcb2
2026-07-15 23:16:17 21. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x000000001af8c0b5
2026-07-15 23:16:17 22. asan_thread_start(void*) @ 0x000000000aa49059
2026-07-15 23:16:17 23. ? @ 0x00007fe94022bac3
2026-07-15 23:16:17 24. ? @ 0x00007fe9402bd8d0
2026-07-15 23:16:17
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 4. Close WriteBufferFromAzureBlobStorage. {}. 8 Close WriteBufferFromAzureBlobStorage. fbkfwlxqtbxdbkflvdnqbavtorgmvcbh. (LogSeriesLimiter: on interval from 2026-07-15 22:35:50 to 2026-07-15 22:37:02 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage)
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 5. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10546.altinitytest (altinity build)) (from [::1]:41450) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests
2026-07-15 23:16:17 -- Even if the fallback is used, invalid substitutions must throw an exception.
2026-07-15 23:16:17 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below):
2026-07-15 23:16:17
2026-07-15 23:16:17 0. ./contrib/llvm-project/libcxx/include/exception:141: Poco::Exception::Exception(String const&, int) @ 0x00000000343c5254
2026-07-15 23:16:17 1. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x000000001adb62c9
2026-07-15 23:16:17 2. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x000000000aa94445
2026-07-15 23:16:17 3. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x000000001803a71a
2026-07-15 23:16:17 4. DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x0000000018042a08
2026-07-15 23:16:17 5. DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000001803cc8a
2026-07-15 23:16:17 6. DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aa92635
2026-07-15 23:16:17 7. DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000000aacf1d5
2026-07-15 23:16:17 8. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd2cfb
2026-07-15 23:16:17 9. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd465c
2026-07-15 23:16:17 10. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000000ccd8030
2026-07-15 23:16:17 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x00000000282b2288
2026-07-15 23:16:17 12. ./contrib/llvm-project/libcxx/include/vector:961: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x00000000282afc77
2026-07-15 23:16:17 13. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x000000002da30ff7
2026-07-15 23:16:17 14. ./build_docker/./src/Processors/QueryPlan/ExpressionStep.cpp:0: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x000000002ddfc0d9
2026-07-15 23:16:17 15. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:714: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000029496f73
2026-07-15 23:16:17 16. ./contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x000000002948f660
2026-07-15 23:16:17 17. ./build_docker/./src/Planner/Planner.cpp:1254: DB::Planner::buildQueryPlanIfNeeded() @ 0x00000000294813db
2026-07-15 23:16:17 18. ./src/Planner/Planner.h:44: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x000000002947c732
2026-07-15 23:16:17 19. ./build_docker/./src/Interpreters/executeQuery.cpp:1182: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000029b940fe
2026-07-15 23:16:17 20. ./build_docker/./src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000029b8e405
2026-07-15 23:16:17 21. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:612: DB::TCPHandler::runImpl() @ 0x000000002d1e4cec
2026-07-15 23:16:17 22. ./build_docker/./src/Server/TCPHandler.cpp:2527: DB::TCPHandler::run() @ 0x000000002d218c00
2026-07-15 23:16:17 23. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x00000000345a29ef
2026-07-15 23:16:17 24. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:48: Poco::Net::TCPServerDispatcher::run() @ 0x00000000345a35d7
2026-07-15 23:16:17 25. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000344a5ceb
2026-07-15 23:16:17 26. ./base/poco/Foundation/include/Poco/SharedPtr.h:231: Poco::ThreadImpl::runnableEntry(void*) @ 0x000000003449fe48
2026-07-15 23:16:17 27. asan_thread_start(void*) @ 0x000000000aa49059
2026-07-15 23:16:17 28. ? @ 0x00007fe94022bac3
2026-07-15 23:16:17 29. ? @ 0x00007fe9402bd8d0
2026-07-15 23:16:17
2026-07-15 23:16:17 message_format_string count() any_message
2026-07-15 23:16:17
2026-07-15 23:16:17 6. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:47392) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2026-07-15 23:16:17 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
� �'�X+�'�X+�'�URLHashInt64�|3�b.�|3�b.�|3�b.�|3�b.�
2026-07-15 23:16:26 o�e�
�#�\X-h�X v�v�h�9�D�|3�b.�CLIDInt32 � $$); (stage: Complete)
2026-07-15 23:16:26
2026-07-15 23:16:26
2026-07-15 23:16:26
2026-07-15 23:16:26 Top short messages:
2026-07-15 23:16:26
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 1. 119 {} Code: 243. DB::Exception: Unable to parse fragment %Y from because readNumber4 requires size >= 4: In scope SELECT pars 35
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 2. 19 Creating {}: {} Creating table test_hbqmlqe5.test: CREATE TABLE IF NOT EXISTS test_hbqmlqe5.test UUID '60dc65f0-f0a1-4738-8a95-343c3828f 124
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 3. 12 Froze {} parts Froze 1 parts -13
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10546.altinitytest (altinity buil 29
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10546.altinitytest (altinity buil 29
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10546.altinitytest (altinity bui 27
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10546.altinitytest (al 29
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10546.altinitytest (altinity build) 24
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10546.altinitytest (altinity build 27
2026-07-15 23:16:26 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate
2026-07-15 23:16:26
2026-07-15 23:16:26 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10546.altinitytest (altinity build 25
2026-07-15 23:16:26
2026-07-15 23:16:26
2026-07-15 23:16:26
2026-07-15 23:16:26 Top messages by level:
2026-07-15 23:16:26
2026-07-15 23:16:26 (0.0027972885429290192,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error
2026-07-15 23:16:26 (0.00002697560546950837,'Not enabled four letter command {}') Warning
2026-07-15 23:16:26 (0.0025831185843529225,'Removing metadata {} of dropped table {}') Information
2026-07-15 23:16:26 (0.0495856587872013,'(from {}{}{}){}{} {} (stage: {})') Debug
2026-07-15 23:16:26 (0.08889565549699488,'is disk {} eligible for search: {}') Trace
2026-07-15 23:16:26
2026-07-15 23:16:26
+ set -e
Files in current directory
+ echo 'Files in current directory'
+ ls -la ./
total 129460
drwxr-xr-x 1 root root 4096 Jul 15 22:53 .
drwxr-xr-x 1 root root 4096 Jul 15 22:53 ..
-rw-rw-r-- 1 1000 1000 119 Jul 15 21:16 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 May 6 11:10 attach_gdb.lib
-rw-r--r-- 1 root root 52 Jul 15 21:21 AzuriteConfig
-rw-r--r-- 1 root root 1541 Jul 15 22:51 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Jul 15 22:38 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2115806 Jul 15 23:15 azurite_log
lrwxrwxrwx 1 root root 7 Apr 9 22:21 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jul 15 22:51 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 1930 Jul 15 21:16 broken_tests.json
drwxr-x--- 4 root root 4096 Jul 15 22:39 data
drwxr-xr-x 14 root root 3840 Jul 15 21:20 dev
-rwxr-xr-x 1 root root 0 Jul 15 21:20 .dockerenv
drwxr-xr-x 1 root root 4096 Jul 15 21:21 etc
drwxr-x--- 2 root root 4096 Jul 15 22:39 flags
drwxr-x--- 2 root root 4096 Jul 15 22:39 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jul 15 21:21 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 9 22:21 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 9 22:21 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 May 6 11:37 mc
drwxr-xr-x 2 root root 4096 Apr 9 22:21 media
drwxr-x--- 2 root root 4096 Jul 15 22:39 metadata
drwxr-x--- 2 root root 4096 Jul 15 22:39 metadata_dropped
-rwxr-xr-x 1 root root 103174296 May 6 11:37 minio
drwxr-xr-x 4 root root 4096 Jul 15 21:21 minio_data
drwxr-xr-x 2 root root 4096 Apr 9 22:21 mnt
drwxr-xr-x 1 root root 4096 May 6 11:02 opt
-rw-r--r-- 1 root root 0 Mar 24 15:40 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jul 15 21:20 package_folder
drwxr-x--- 2 root root 4096 Jul 15 22:42 preprocessed_configs
dr-xr-xr-x 320 root root 0 Jul 15 21:20 proc
-rwxrwxr-x 1 root root 10295 May 6 11:01 process_functional_tests_result.py
-rw-r----- 1 root root 1 Jul 15 22:39 quotas.list
-rw-rw-r-- 1 root root 837 May 6 11:10 requirements.txt
-rw-r----- 1 root root 1 Jul 15 22:39 roles.list
drwx------ 1 root root 4096 Jul 15 23:11 root
-rw-r----- 1 root root 1 Jul 15 22:39 row_policies.list
drwxr-xr-x 1 root root 4096 Jul 15 21:21 run
-rwxrwxr-x 1 root root 22124 May 6 11:10 run.sh
lrwxrwxrwx 1 root root 8 Apr 9 22:21 sbin -> usr/sbin
-rw-r--r-- 1 root root 65685 Jul 15 22:47 server.log
-rw-r----- 1 root root 1 Jul 15 22:39 settings_profiles.list
-rwxrwxr-x 1 root root 10374 May 6 11:10 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 May 6 11:10 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 May 6 11:10 setup_minio.sh
drwxr-xr-x 2 root root 4096 Apr 9 22:21 srv
-rw-r--r-- 1 root root 399 Jul 15 21:23 ssh_key
-rw-r----- 1 root root 65 Jul 15 22:42 status
drwxr-x--- 4 root root 4096 Jul 15 22:39 store
-rw-rw-r-- 1 root root 14015 May 6 11:10 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jul 15 21:20 sys
drwxrwxr-x 2 1000 1000 4096 Jul 15 21:22 test_output
drwxrwxrwt 1 root root 4096 Jul 15 23:16 tmp
drwxr-x--- 2 root root 4096 Jul 15 22:39 user_files
-rw-r----- 1 root root 1 Jul 15 22:39 users.list
drwxr-xr-x 1 root root 4096 Apr 9 22:21 usr
-rw-rw-r-- 1 root root 897 May 6 11:10 utils.lib
-rw-r----- 1 root root 36 Jul 15 22:39 uuid
drwxr-xr-x 1 root root 4096 Apr 9 22:31 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 129460
drwxr-xr-x 1 root root 4096 Jul 15 22:53 .
drwxr-xr-x 1 root root 4096 Jul 15 22:53 ..
-rw-rw-r-- 1 1000 1000 119 Jul 15 21:16 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 2380 May 6 11:10 attach_gdb.lib
-rw-r--r-- 1 root root 52 Jul 15 21:21 AzuriteConfig
-rw-r--r-- 1 root root 1541 Jul 15 22:51 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4241 Jul 15 22:38 __azurite_db_blob__.json
-rw-r--r-- 1 root root 2115806 Jul 15 23:15 azurite_log
lrwxrwxrwx 1 root root 7 Apr 9 22:21 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Jul 15 22:51 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
-rw-rw-r-- 1 1000 1000 1930 Jul 15 21:16 broken_tests.json
drwxr-x--- 4 root root 4096 Jul 15 22:39 data
drwxr-xr-x 14 root root 3840 Jul 15 21:20 dev
-rwxr-xr-x 1 root root 0 Jul 15 21:20 .dockerenv
drwxr-xr-x 1 root root 4096 Jul 15 21:21 etc
drwxr-x--- 2 root root 4096 Jul 15 22:39 flags
drwxr-x--- 2 root root 4096 Jul 15 22:39 format_schemas
drwxr-xr-x 1 1000 1000 4096 Jul 15 21:21 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 9 22:21 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 9 22:21 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 9 22:21 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 26927256 May 6 11:37 mc
drwxr-xr-x 2 root root 4096 Apr 9 22:21 media
drwxr-x--- 2 root root 4096 Jul 15 22:39 metadata
drwxr-x--- 2 root root 4096 Jul 15 22:39 metadata_dropped
-rwxr-xr-x 1 root root 103174296 May 6 11:37 minio
drwxr-xr-x 4 root root 4096 Jul 15 21:21 minio_data
drwxr-xr-x 2 root root 4096 Apr 9 22:21 mnt
drwxr-xr-x 1 root root 4096 May 6 11:02 opt
-rw-r--r-- 1 root root 0 Mar 24 15:40 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Jul 15 21:20 package_folder
drwxr-x--- 2 root root 4096 Jul 15 22:42 preprocessed_configs
dr-xr-xr-x 320 root root 0 Jul 15 21:20 proc
-rwxrwxr-x 1 root root 10295 May 6 11:01 process_functional_tests_result.py
-rw-r----- 1 root root 1 Jul 15 22:39 quotas.list
-rw-rw-r-- 1 root root 837 May 6 11:10 requirements.txt
-rw-r----- 1 root root 1 Jul 15 22:39 roles.list
drwx------ 1 root root 4096 Jul 15 23:11 root
-rw-r----- 1 root root 1 Jul 15 22:39 row_policies.list
drwxr-xr-x 1 root root 4096 Jul 15 21:21 run
-rwxrwxr-x 1 root root 22124 May 6 11:10 run.sh
lrwxrwxrwx 1 root root 8 Apr 9 22:21 sbin -> usr/sbin
-rw-r--r-- 1 root root 65685 Jul 15 22:47 server.log
-rw-r----- 1 root root 1 Jul 15 22:39 settings_profiles.list
-rwxrwxr-x 1 root root 10374 May 6 11:10 setup_export_logs.sh
-rwxrwxr-x 1 root root 360 May 6 11:10 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3456 May 6 11:10 setup_minio.sh
drwxr-xr-x 2 root root 4096 Apr 9 22:21 srv
-rw-r--r-- 1 root root 399 Jul 15 21:23 ssh_key
-rw-r----- 1 root root 65 Jul 15 22:42 status
drwxr-x--- 4 root root 4096 Jul 15 22:39 store
-rw-rw-r-- 1 root root 14015 May 6 11:10 stress_tests.lib
dr-xr-xr-x 13 root root 0 Jul 15 21:20 sys
drwxrwxr-x 2 1000 1000 4096 Jul 15 21:22 test_output
drwxrwxrwt 1 root root 4096 Jul 15 23:16 tmp
drwxr-x--- 2 root root 4096 Jul 15 22:39 user_files
-rw-r----- 1 root root 1 Jul 15 22:39 users.list
drwxr-xr-x 1 root root 4096 Apr 9 22:21 usr
-rw-rw-r-- 1 root root 897 May 6 11:10 utils.lib
-rw-r----- 1 root root 36 Jul 15 22:39 uuid
drwxr-xr-x 1 root root 4096 Apr 9 22:31 var
+ /process_functional_tests_result.py
2026-07-15 23:16:27,078 File /analyzer_tech_debt.txt with broken tests found
2026-07-15 23:16:27,080 File /broken_tests.json with broken tests found
2026-07-15 23:16:27,081 Broken tests in the list: 4
2026-07-15 23:16:27,081 Find files in result folder test_result.txt,run.log,minio.log,hdfs_minicluster.log
2026-07-15 23:16:27,132 Is flaky check: False
2026-07-15 23:16:27,132 Result parsed
2026-07-15 23:16:27,144 Result written
+ clickhouse-client -q 'system flush logs'
+ stop_logs_replication
+ echo 'Detach all logs replication'
Detach all logs replication
+ tee /dev/stderr
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log
+ clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes'
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ sleep 1
+ clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE'
+ clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow'
+ sudo clickhouse stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Sent terminate signal to process with pid 599.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 599.
The process with pid = 599 does not exist.
Server stopped
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ kill 1446
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
+ :
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 0 -ne 0 ']'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ check_logs_for_critical_errors
+ sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log
+ rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp
+ echo -e 'No sanitizer asserts\tOK\t\N\t'
+ rm -f /test_output/tmp
+ rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t'
+ rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No logical errors\tOK\t\N\t'
+ '[' -s /test_output/logical_errors.txt ']'
+ rm /test_output/logical_errors.txt
+ rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ grep -v a.myext
+ echo -e 'No lost s3 keys\tOK\t\N\t'
+ grep SharedMergeTreePartCheckThread
+ rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/no_such_key_errors.txt ']'
+ rm /test_output/no_such_key_errors.txt
+ rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'Not crashed\tOK\t\N\t'
+ rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log
+ echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t'
+ '[' -s /test_output/fatal_messages.txt ']'
+ rm /test_output/fatal_messages.txt
+ rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst
+ rg -Fa ' received signal ' /test_output/gdb.log
/test_output/gdb.log: No such file or directory (os error 2)
+ dmesg -T
+ grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log
+ echo -e 'No OOM in dmesg\tOK\t\N\t'
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/
+ tar -chf /test_output/store.tar /var/lib/clickhouse/store
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_2hirxbqy.sql /var/lib/clickhouse/metadata/test_3rt1mio2_1.sql /var/lib/clickhouse/metadata/test_it773nbi.sql /var/lib/clickhouse/metadata/test_pa94hu8v.sql /var/lib/clickhouse/metadata/test.sql
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ 0 -eq 1 ]]
+ [[ 0 -eq 1 ]]
+ collect_core_dumps
+ find . -type f -maxdepth 1 -name 'core.*'
+ read -r core